Disusun oleh:


Selama lebih dari puluhan tahun misteri motivasi dan kinerja diungkap oleh para pakar psikologi untuk mencari akar masalah terjadinya motivasi dan demotivasi di lingkungan kerja. Beberapa ahli psikologi bahkan ada yang melakukan riset dan eksperimen untuk mengkaji terjadinya motivasi dalam pekerjaan dan menentukan faktor-faktor yang dapat meningkatkan motivasi atau menurunkan motivasi individu di tempat kerja.


Istilah motivasi berasal dari bahasa latin yaitu movere yang berarti bergerak atau menggerakkan. Motivasi diartikan juga sebagai suatu kekuatan sumber daya yang menggerakkan dan mengendalikan perilaku manusia. Motivasi sebagai upaya yang dapat memberikan dorongan kepada seseorang untuk mengambil suatu tindakan yang dikehendaki, sedangkan motif sebagai daya gerak seseorang untuk berbuat. Karena perilaku seseorang cenderung berorientasi pada tujuan dan didorong oleh keinginan untuk mencapai tujuan tertentu.

Dalam konteks pekerjaan, motivasi merupakan salah satu faktor penting dalam mendorong seorang karyawan untuk bekerja. Motivasi adalah kesediaan individu untuk mengeluarkan upaya yang tinggi untuk mencapai tujuan organisasi (Stephen P. Robbins, 2001). Ada tiga elemen kunci dalam motivasi yaitu upaya, tujuan organisasi dan kebutuhan. Upaya merupakan ukuran intensitas. Bila seseorang termotivasi maka ia akan berupaya sekuat tenaga untuk mencapai tujuan, namun belum tentu upaya yang tinggi akan menghasilkan kinerja yang tinggi. Oleh karena itu, diperlukan intensitas dan kualitas dari upaya tersebut serta difokuskan pada tujuan organisasi. Kebutuhan adalah kondisi internal yang menimbulkan dorongan, dimana kebutuhan yang tidak terpuaskan akan menimbulkan tegangan yang merangsang dorongan dari dalam diri individu. Dorongan ini menimbulkan perilaku pencarian untuk menemukan tujuan, tertentu. Apabila ternyata terjadi pemenuhan kebutuhan, maka akan terjadi pengurangan tegangan. Pada dasarnya, karyawan yang termotivasi berada dalam kondisi tegang dan berupaya mengurangi ketegangan dengan mengeluarkan upaya.

Proses motivasi yang menunjukkan kebutuhan yang tidak terpuaskan akan meningkatkan tegangan dan memberikan dorongan pada seseorang dan menimbulkan perilaku digambarkan sebagai berikut:

Kebutuhan tidak terpuaskan



Perilaku Pencarian

Pengurangan Tegangan

Kebutuhan Terpuaskan

Pada umumnya kinerja yang tinggi dihubungkan dengan motivasi yang tinggi. Sebaliknya, motivasi yang rendah dihubungkan dengan kinerja yang rendah. Kinerja seseorang kadang-kadang tidak berhubungan dengan kompetensi yang dimiliki, karena terdapat faktor diri dan lingkungan kerja yang mempengaruhi kinerja.

Kinerja yang tinggi adalah fungsi dan interaksi antara motivasi, kompetensi dan peluang sumber daya pendukung, sehingga kinerja dapat dirumuskan sebagai berikut:

Kinerja = f ( Motivasi x Kompetensi x Kesempatan )


Terdapat 5 teori motivasi yang paling popular dan berpengaruh besar dalam praktek pengembangan sumber daya manusia dalam suatu organisasi.

1. Teori Efek Hawthorn

Penelitian oleh Elton Mayo pada perusahaan General Electric kawasan Hawthorn di Chicago, memilki dampak pada motivasi kelompok kerja dan sikap karyawan dalam bekerja. Kontribusi hasil penelitian tersebut bagi perkembangan teori motivasi adalah:

· Kebutuhan dihargai sebagai manusia ternyata lebih penting dalam meningkatkan motivasi dan produktivitas kerja karyawan dibandingkan dengan kondisi fiisik lingkungan kerja.

· Sikap karyawan dipengaruhi oleh kondisi yang terjadi baik di dalam maupun di luar lingkungan tempat kerja.

· Kelompok informal di lingkungan kerja berperan penting dalam membentuk kebiasaan dan sikap para karyawan.

· Kerjasama kelompok tidak terjadi begitu saja, tetapi harus direncanakan dan dikembangkan.

2. Teori Kebutuhan

Menurut Abraham Maslow, pada dasarnya karyawan bekerja untuk memenuhi kebutuhan sebagai berikut:

· Kebutuhan fisiologis.

· Kebutuhan rasa aman.

· Kebutuhan social.

· Kebutuhan harga diri.

· Kebutuhan aktualisasi diri.

Kebutuhan-kebutuhan tersebut bersifat hierarkis, yaitu suatu kebutuhan akan timbul apabila kebutuhan dasar sebelumnya telah dipenuhi. Setelah kebutuhan fisiologis seperti pakaian, makanan dan perumahan terpenuhi, maka kebutuhan tersebut akan digantikan dengan kebutuhan rasa aman dan seterusnya. Sehingga tingkat kebutuhan seseorang akan berbeda-beda dalam bekerja. Seseorang yang kebutuhan hanya sekedar makan, maka pekerjaan apapun akan dilakukan untuk memenuhi kebutuhan tersebut.

3. Teori X dan Y

McGregor mengemukakan dua model yang menjelaskan motivasi karyawan yang bekerja yaitu teori X dan teori Y.

Teori X menganggap bahwa:

· Karyawan tidak suka bekerja dan cenderung untuk menghindari kerja.

· Karyawan harus diawasi dengan ketat dan diancam agar mau bekerja dengan baik.

· Prosedur dan disiplin yang keras lebih diutamakan dalam bekerja.

· Uang bukan satu-satunya faktor yang memotivasi kerja.

· Karyawan tidak perlu diberikan kesempatan untuk mengembangkan diri.

Teori Y menganggap bahwa:

· Karyawan senang bekerja, sehingga pengawasan dan hukuman tidak diperlukan oleh karyawan.

· Karyawan akan memiliki komitmen terhadap pekerjaan dan organisasi jika merasa memuaskan.

· Manusia cenderung ingin belajar.

· Kreatifitas dan Imajinasi digunakan untuk memecahkan masalah.

4. Teori Hygine dan Motivator

Menurut Herzberg, faktor yang menimbulkan kepuasan kerja karyawan berbeda dengan faktor yang menimbulkan ketidak-puasan kerja sebagai berikut.

Faktor Hygine meliputi :

· Kebijakan perusahaan dan sistem administrasinya.

· Sistem pengawasan.

· Gaya kepemimpinan.

· Kondisi lingkungan kerja.

· Hubungan antar pribadi.

· Gaji / upah.

· Status.

· Kesehatan dan keselamatan kerja.

Faktor Motivator meliputi :

· Pengakuan.

· Penghargaan atas prestasi.

· Tanggungjawab yang lebih besar.

· Pengembangan karir.

· Pengembangan diri.

· Minat terhadap pekerjaan.

5. Teori Motivasi Berprestasi

David McClelland menjelaskan tentang keinginan seseorang untuk mencapai kinerja yang tinggi. Hasil penelitian tentang motivasi berprestasi menunjukkan pentingnya menetapkan target atau standar keberhasilan. Karyawan dengan ciri-ciri motivasi berprestasi yang tinggi akan memiliki keinginan bekerja yang tinggi. Karyawan lebih mementingkan kepuasan pada saat target telah tercapai dibandingkan imbalan atas kinerja tersebut. Hal ini bukan berarti mereka tidak mengharapkan imbalan, melainkan mereka menyukai tantangan.

Ada tiga macam kebutuhan yang dimiliki oleh setiap individu yaitu:

· Kebutuhan berprestasi (Achievement motivation) yang meliputi tanggung jawab pribadi, kebutuhan untuk mencapai prestasi, umpan balik dan mengambil risiko sedang.

· Kebutuhan berkuasa (Power motivation) yang meliputi persaingan, mempengaruhi orang lain.

· Kebutuhan berafiliasi (Affiliation motivation) yang meliputi persahabatan, kerjasama dan perasaan diterima.

Dalam lingkungan pekerjaan, ketiga macam kebutuhan tersebut saling berhubungan, karena setiap karyawan memiliki semua kebutuhan tersebut dengan kadar yang berbeda-beda. Seseorang dapat dilatihkan untuk meningkatkan salah satu dari tiga faktor kebutuhan ini. Misalnya untuk meningkatkan kebutuhan berprestasi kerja, maka karyawan dapat dipertajam tingkat kebutuhan berprestasi dengan menurunkan kebutuhan yang lain.


McClelland seorang pakar psikologi dari Universitas Harvard di Amerika Serikat mengemukakan bahwa kinerja seseorang dapat dipengaruhi oleh virus mental yang ada pada dirinya. Virus tersebut merupakan kondisi jiwa yang mendorong seseorang untuk mencapai kinerja secara optimal. Ada tiga jenis virus sebagai pendorong kebutuhan yaitu kebutuhan berprestasi, kebutuhan berafiliasi dan kebutuhan berkuasa. Karyawan perlu mengembangkan virus tersebut melalui lingkungan kerja yang efektif untuk meningkatkan kinerja dan mencapai tujuan perusahaan.

Motivasi berprestasi merupakan suatu dorongan dengan ciri-ciri seseorang melakukan pekerjaan dengan baik dan kinerja yang tinggi. Kebutuhan akan berprestasi tinggi merupakan suatu dorongan yang timbul pada diri seseorang untuk berupaya mencapai target yang telah ditetapkan, bekerja keras untuk mencapai keberhasilan dan memiliki keinginan untuk mengerjakan sesuatu secara lebih lebih baik dari sebelumnya.

Karyawan dengan motivasi berprestasi tinggi sangat menyukai tantangan, berani mengambil risiko, sanggup mengambil alih tanggungjawab, senang bekerja keras. Dorongan ini akan menimbulkan kebutuhan berprestasi karyawan yang membedakan dengan yang lain, karena selalu ingin mengerjakan sesuatu dengan lebih baik. Berdasarkan pengalamam dan antisipasi dari hasil yang menyenangkan serta jika prestasi sebelumnya dinilai baik, maka karyawan lebih menyukai untuk terlibat dalam perilaku berprestasi. Sebaliknya jika karyawan telah dihukum karena mengalami kegagalan, maka perasaan takut terhadap kegagalan akan berkembang dan menimbulkan dorongan untuk menghindarkan diri dari kegagalan.

Ciri-ciri perilaku karyawan yang memiliki motivasi berprestasi yang tinggi menurut McClelland adalah:

· Menyukai tanggungjawab untuk memecahkan masalah.

· Cenderung menetapkan target yang sulit dan berani mengambil risiko.

· Memiliki tujuan yang jelas dan realistik.

· Memiliki rencana kerja yang menyeluruh.

· Lebih mementingkan umpan balik yang nyata tentang hasil prestasinya.

· Senang dengan tugas yang dilakukan dan selalu ingin menyelesaikan dengan sempurna.

Sebaliknya ciri-ciri karyawan yang memiliki motivasi berprestasi rendah adalah:

· Bersikap apatis dan tidak percaya diri.

· Tidak memiliki tanggungjawab pribadi dalam bekerja.

· Bekerja tanpa rencana dan tujuan yang jelas.

· Ragu-ragu dalam mengambil keputusan.

· Setiap tindakan tidak terahan dan menyimpang dari tujuan.

Laporan hasil penelitian tentang gaya manajerial dari 16.000 manajer di Amerika Serikat yang memiliki motivasi berprestasi yang tinggi, menengah dan rendah menunjukkan sebagai berikut :

· Manajer dengan motivasi berprestasi yang rendah memiliki karakter pesimis dan tidak percaya dengan kemampuan bawahannya. Sedangkan manajer dengan motivasi berprestasi tinggi sangat optimis dan memandang bawahan baik dan menyenangkan.

· Motivasi manajer dapat diproyeksikan pada bawahannya. Bagi manajer yang bermotivasi prestasi tinggi selalu memperhatikan aspek-aspek pekerjaan yang harus diselesaikan dan mendiskusikan tugas pekerjaan yang harus dicapai bawahannya, sehingga mereka akan menerima.

· Manajer yang bermotivasi berprestasi tinggi cenderung menggunakan metode partisipasi terhadap bawahannya, sedangkan manajer dengan motivasi berprestasi sedang dan rendah selalu menghindar dalam interaksi dan komunikasi terbuka.

· Manajer yang prestasinya tinggi lebih memperhatikan pada manusia dan tugas / produksi, manajer yang prestasinya sedang lebih memperhatikan tugas / produksi, sedangkan manajer yang prestasinya rendah hanya memperhatikan kepentingan pribadi dan tidak menghiraukan bawahannya.

Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa terdapat hubungan yang signifikan antara motivasi berprestasi dengan tingkat kinerja. Artinya, para karyawan yang memiliki motivasi berprestasi tinggi akan cenderung memiliki tingkat kinerja yang tinggi. Sebaliknya, mereka yang motivasi berprestasinya rendah kemungkinan akan memperoleh kinerja yang rendah.


Beberapa teknik untuk memotivasi kerja sebagai berikut :

1. Teknik Pemenuhan Kebutuhan

Pemenuhan kebutuhan merupakan dasar bagi perilaku kerja. Motivasi kerja akan timbul apabila kebutuhan dipenuhi seperti dikemukakan oleh Maslow tentang hierarki kebutuhan individu yaitu :

· Kebutuhan fisiologis, yaitu kebutuhan makan, minum, perumahan dan seksual. Kebutuhan ini paling mendasar bagi manusia. Dalam bekerja, maka kebutuhan karyawan yang harus dipenuhi adalah gaji / upah yang layak.

· Kebutuhan rasa aman, yaitu kebutuhan perlindungan dari ancaman bahaya dan lingkungan kerja. Dalam bekerja, karyawan memerlukan tunjangan kesehatan, asuransi dan dana pensiun.

· Kebutuhan sosial, yaitu kebutuhan diterima dalam kelompok dan saling mencintai. Dalam hubungan ini, karyawan ingin diterima keberadaanya di tempat kerja, melakukan interaksi kerja yang baik dan harmonis.

· Kebutuhan harga diri, yaitu kebutuhan untuk dihormati dan dihargai oleh orang lain. Dalam hubungan ini, karyawan butuh penghargaan dan pengakuan serta tidak diperlakukan sewenang-wenang.

· Kebutuhan aktualisasi diri, yaitu kebutuhan untuk mengembangkan diri dan potensi. Dalam hubungan ini, karyawan perlu kesempatan untuk tumbuh dan berkembang secara pribadi.

2. Teknik Komunikasi Persuasif

Teknik komunikasi persuasif adalah satu teknik memotivasi kerja yang dilakukan dengan cara mempengaruhi dari luar diri. Rumus teknik komunikasi persuasif adalah ADIDAS sebagai berikut :

· A ttention, yaitu perhatian yang penuh

· D esire, yaitu hasrat dan keinginan yang membara

· I interest, yaitu minat dan kepentingan

· D esicion, yaitu keputusan yang tepat

· A ction, yaitu tindakan nyata

· S atisfaction, yaitu kepuasan atas hasil yang dicapai


Memotivasi merupakan salah satu faktor kunci untuk bekerja dan mencapai kinerja yang tinggi. Kegiatan memotivasi berkaitan dengan sejauhmana komitmen seseorang terhadap pekerjaannya dalam rangka mencapai tujuan perusahaan. Karyawan yang motivasinya terhadap suatu pekerjaan rendan atau turun akan memiliki komitmen terhadap pelaksanaan penyelesaian pekerjaannya. Karyawan tersebut termasuk orang yang kurang semangat atau motivasi rendah. Pada dasarnya, yang membuat karyawan kehilangan motivasi atau tidak semangat adalah situasi dan kondisi pekerjaan itu sendiri.

Tanda-tanda karyawan yang termotivasi dengan baik

Untuk mengetahui apakah seorang karyawan memiliki motivasi yang tinggi dalam melakukan tugas akan dapat diketahui dengan mengamati karyawan dengan tanda-tanda motivasi baik adalah :

· Bersikap positif terhadap pekerjaannya

· Menunjukkan perhatian yang tulus terhadap pekerjaan orang lain dan membantu mereka bekerja lebih baik

· Selalu menjaga kesimbangan sikap dalam berbagai situasi

· Suka memberi motivasi kepada orang lain walaupun kadang tidak berhasil

· Selalu berpikir positif dari suatu kejadian

Tanda-tanda karyawan yang termotivasi dengan buruk

Untuk mengetahui apakah seorang karyawan kehilangan motivasi tidak selalu mudah karena jarang diungkapkan. Namun hal ini dapat diketahui dari perubahan sikap yang terjadi pada dirinya yang dapat diamati. Tanda-tanda sikap karyawan yang tidak memiliki motivasi kerja adalah :

· Tidak bersedia bekerja sama

· Tidak mau menjadi sukarelawan

· Selalu datang terlambat, pulang awal dan mangkir tanpa alasan

· Memperpanjang waktu istirahat dan bermain game dalam waktu kerja

· Tidak menepati tenggat waktu tugas

· Tidak mengikuti standar yang ditetapkan

· Selalu mengeluh tentang hal sepele

· Saling menyalahkan

· Tidak mematuhi peraturan

Cara mengatasi penurunan motivasi

Suatu hal yang perlu diperhatikan agar karyawan dan perusahaan tidak mengalami kerugian akibat penutunan motivasi, maka kita perlu mengatasi masalah tersebut dan mencegah dengan berupaya mengantisipasi kondisi yang terjadi.

Beberapa pendekatan untuk mengatasi atau mengurangi kekurangan semangat dan motivasi dalam melaksanakan pekerjaan adalah dengan pendekatan kuratif dan pendekatan preventif.

1. Pendekatan Kuratif

Pendekatan kuratif atau mengatasi adalah melihat apakah masalah yang menimbulkan pengaruh pada motivasi penting atau tidak dalam pekerjaan. Apabila masalahnya tidak terlalu penting maka kita tidak perlu merasa putus asa. Tetapi bila ternyata masalah itu penting dalam pekerjaan, maka bicara secara terbuka dan langsung dengan pihak yang berwenang untuk mendapatkan kesamaan persepsi sehingga jalan keluarnya dapat ditemukan, misalnya atasan atau konselor. Bila pihak yang berwenang tidak dapat ditemui secara langsung, hubungi melalui surat atau telepon.

2. Pendekatan Antisipatif

Karyawan sebaiknya bekerja dengan sebaik-baiknya dan sesuai dengan ketentuan yang telah ditetapkan. Selanjutnya berusaha menenangkan hati sewaktu bekerja dan jangan terganggu dengan perasaan gelisah. Bila merasa gelisah karena hal-hal yang tidak berkaitan dengan pekerjaan, maka sebaiknya menenagkan diri di luar ruang kerja dengan cara yang diyakini berhasil, misalnya dengan berdoa atau yoga. Karyawan disarankan bersikap dan berpikir positif terhadap pekerjaan.

About these ads


  1. 1 orie May 15, 2008 at 9:03 am

    salam kenal pak….

    boleh minta bantuannya sedikit ga?

    saya sedang kebingungan mencari pengertian ttg lingkungan kerja serta faktor2 yang mempengaruhi kinerja seseorang dalam konteks lingkungan kerja tersebut…
    tlg bantu saya, dan mohon dikirimkan kembali melalui e-mail saya…

    terima kasih

    • 2 lilis mulyati February 20, 2014 at 4:43 am


      Yang dimaksud motivasi ialah daya dorong yang dimiliki , baik secara intrinsik maupun ekstrinsik, yang membuatnya mau dan rela untuk bekerja sekuat tenaga dengan mengarahkan segala kemampuannya demi keberhasilan organisasi dalam mencapai tujuan dan berbagai sasarannya.
      Yang dimaksud kinerja ialah apa yang telah dicapai,prestasi kerja yang dilihat, atau kemampuan kerja (kamus bahasa Indonesia).
      Berkaitan dengan kinerja,Sondang P. Siagian mengemukakan bahwa kinerja seseorang dan produktivitas kerjanya diterntukan oleh tiga faktor, yaitu motivasi, kemampuan dan ketepatan penugasan. Ada beberapa faktor yang dapat menimbulkan motivasi kerja Guru dianataranya , dorongan untuk bekerja, tanggung jawab terhadap tugas, minat terhadap tugas, dan penghargaan terhadap tugas. Kinerja guru dapat diukur dari tugas utama guru, yaitu kinerja guru dalam mendesain program pengajaran dan kinerja guru dalam melaksanakan proses belajar mengajar. Dewasa ini pemerintah melakukan berbagai upaya untuk mengembangkan standar kompetensidan sertifikasi guru dengan disyahkannya UU guru dan dosen yang dilakukan untuk meningkatkan profesionalisme dan kompetensi guru.
      Untuk meningkatkan motivasi dan kinerja dalam rangka menuju era informasi dan era teknologi sekaligus era globalisasi, maka seorang guru harus mrningkatkan SDM yang ada pada dirinya. Untuk mencetak SDM guru yang berkualitas , yang mampu bersanding bahkan bersaing dengan Negara Maju diperlukan guru dan tenaga kependidikan yang profesional, yang merupakan penentu utanma keberhasilan pendidikan. Hal ini penting , terutama jika dikaitkan dengan berbagai kajian dan hasil penelitian yang menunjukkan bahwa guru memiliki peranan yang sangat stertegis dalam menentukankeberhasilan pendidikan dan meningkatkan kualitas pembelajaran serta membentuk kompetensi peserta didik.
      Supaya tugas dan tanggung jawab guru dapat dilaksanakan dengan baik, maka guru harus mempunyai kinerja yang baik. Yaitu seorang guru harus mempunyai kemampuan ,kemauan, dan usaha dalam kegiatan proses belajar mengajar yang meliputi perencanaan, pengorganisasian, pelaksanaan, dan evaluasi hasil belajar. Disamping itu guru juga harus memiliki sedikitya dua kompetensi yang harus ada pada dirinya, yaitu :
      a. Kompetensi profesional, yang meliputi kemahiran merancang,melaksanakan dan menilai tugas sebagai guru, yang meliputi penugasan ilmu pengetahuan dan teknologi pendidikan.
      b. Kompetensi personal, yang meliputi etika, moral, pengabdian, kemampuan sosial, dan kemampuan spiritual.
      Ujung tombak dari setiap kebijakan atau yang berkaitan dengan pendidikan, akhirnya berpulang pada makhluk yang bernama guru, Pengembangan sunber daya guru wajib dilakukan untuk mencapai tujuan pendidikan nasioanl secara menyeluruh. Kualitas kemampuan guru akan berdampak pada mutu pendidikan.


  2. 3 Rakhmat Yusandi June 2, 2008 at 1:00 pm

    Assalamu alaikum wr. wb.
    ternyata motivasi sangat mempengaruhi kinerja…
    Dan dapat kita deteksi seberapa besar motivasi karyawan terhadap kinerjanya..Kemudian kita juga dapat memotivasi karyawan juga lho…
    Tapi ada sedikit kebingungan mengenai teori Hawrthorn pada hasil penelitian oleh elton mayo pada perusahaan General Elektrik di kawasan Hawrthorn Chicago…
    Seperti apa sih contoh real dari setiap butir kontribusi hasil penelitian tersebut bagi perkembangan teori motivasi…

    Terima kasih sebelumnya….
    Wassalamu alaikum Wr. Wb.

    • 4 Permadi February 7, 2014 at 8:09 am

      Assalamulaikum wr. wb

      Terimakasih atas tulisannya Bapak dan ada beberapa yang bisa saya diskusikan atau sampaikan.

      Saya sependapat bahwa motivasi akan mendorong seseorang atau kelompok dan bahkan organisasi untuk mewujudkan tujuan dalam hidup dan kehidupan artinya baik secara individu maupun organisasi.
      Saya ada baca buku “Manajemen SDM” karangan. Prof. Dr. Hj. Sedarmayanti, M.PD., APU dimana dituliskan bahwa motivasi melekat dengan teori harapan oleh Victor Vroom, asumsinya bahwa :
      1. Hubungan upaya-kinerja, probabilitas yang dipersepsikan oleh individu yang mengeluarkan sejumlah upaya tertentu akan mendorong kinerja.
      2. Hubungan kinerja-ganjaran, derajat sejauhmana individu mampu meyakini bahwa berkinerja pada tingkat tertentu akan mendorong tercapainya keluaran yang diinginkan.
      3. Hubungan ganjaran-tujuan pribadi, derajat sejauhmana ganjaran organisasi memenuhi tujuan/kebutuhan pribadi seseorang individu dan data tarik ganjaran potensial untuk individu.

      Kalau melihat kondisi karyawan atau pegawai saat ini, disemua lini dan tingkatan, adanya kecenderungan yang sangat kuat dimana tindakan dalam cara tertentu bergantung pada kekuatan pengharapan, karena banyak karyawan tidak termotivasi pada pekerjaannya dan semata-mata melakukan yang minimum untuk menyelamatkan diri. Kalau dengan ungkapan saya “banyak karyawan atau pegawai yang hanya bekerja dengan prinsip “gugur tugas” artinya sebatas menyelesaikan pekerjaan tanpa memaknai apa yang telah dikerjakan.

      kesimpulan yang dapat saya sampaikan adalah bahwa karyawan akan termotivasi untuk mencurahkan usaha dan kemampuannya apabila motivasi bekerja diyakini akan menghasilkan kinerja, bekerja dengan kinerja yang tinggi akan menghasilkan penghargaan, dan kesedian karyawan bekerja dengan kinerja yang tinggi akan sangat ditentukan oleh seberapa tinggi organisasi akan memberikan penghargaan.

      R. Permadi M
      NIM. 72113168
      Kelas Sukabumi

  3. 5 wulan June 4, 2008 at 10:40 am

    pak, saya mau tanya ciri2 n indikator motivasi berprestasi teorinya McClelland tapi bkn pada karyawan. penelitian saya motivasi berprestasi pada remaja cacat. mungkin bapak juga tau literatur seputaran motivasi berprestasi. mohon bantuannya y pak..

  4. 6 ugi Gumilar( mahasiswa PSDM) June 7, 2008 at 5:21 am

    Sebuah organisasi memerlukan manusia sebagai sumber daya pendukung utama untuk mencapai tujuan yang telah ditetapkan. Sumber daya manusia yang berkualitas akan turut memajukan organisasi sebagai suatu wadah peningkatan produkrivitas kerja. Kedudukan strategis untuk meningkatkan produktivitas organisasi adalah pegawai, yaitu individu-individu yang bekerja pada suatu organisasi atau perusahaan. Pegawai yang kompeten memiliki karakteristik dari produktivitas kerjanya. Peningkatan produktivitas kerja dapat terwujud dengan motivasi dan sikap kerja maksimal para pegawainya, serta aspek lain yang dapat mempengaruhi produktivitas kerja.
    Rumusan masalah dalam penelitian ini adalah “Apakah motivasi dan sikap kerja pegawai cukup berpengaruh terhadap produktivitas kerjanya ?”.Tujuannya adalah untuk mengetahui dan memperoleh gambaran mengenai pengaruh motivasi dan sikap kerja pegawai administratif terhadap produktivitasnya. Sedangkan hipotesisnya adalah motivasi kerja berpengaruh secara signifikan terhadap produktivitasnya, sikap kerja berpengaruh secara signifikan terhadap produktivitasnya, motivasi dan sikap kerja berpengaruh secara signifikan terhadap produktivitas kerja pegawai.
    jadi kesimpulannya motivasi merupakan element yang tiddak bisa dipisahkan ketika kita membahas tentang masalah kesenjangan kinerja.
    motivasi merupakan salah satu trik untuk meningkatkan kinerja. kan sudah di bilang kalo sudah da kemauan pasti ada jalan untuk maju/ memperbaiki kinerja seseorang.

    terimakasih pa kesempatannya untuk memberikan pendapat tentang artikel2 yang bapak muat.

  5. 7 Evita Ardhyana; TP UNJ (Mata Kuliah PSDM) June 8, 2008 at 2:41 am

    Menurut saya peran motivasi terhadap peningkatan kinerja sangatlah tinggi, sebelum membahas kinerja tentunya kita harus memikirkan bagaimana seorang pegawai termotivasi untuk belajar sehingga nantinya berpengaruh pada peninggkatan kinerjanya menjadi lebih baik. Training sebagai salah satu cara untuk belajar harus dapat dimanfaatkan sebagai cara untuk meningkatkan kompetensi sehingga meningkatkan motivasi pegawai untuk berkinerja lebih baik pada perusahaan. Oleh karena itu training harus dirancang sedemikian rupa guna meningkatkan motivasi pegawai.
    1. Relevan.
    Pegawai akan termotivasi untuk belajar jika meteri yang disampaikan pada pelatihan relevan bagi mereka, sehingga meraka dapat mengaitkan dengan kebutuhan nya untuk berkinerja lebih baik.
    2. Mengguntungkan.
    Pegawai akan lebih termotivasi untuk belajar jika mereka mengetahui bahwa pelatihan tersebut mengguntungkan bagi mereka. Dalam hal ini perlu dikaitkan antara pelatihan tersebut dengan dampaknya bagi peningkatan kinerja.
    3. Menarik.
    Pegawai akan lebih termotivasi untuk belajar jika pelatihan itu menarik, jadi perlu menggunakan metode yang dapat membuat proses pembelajaran menjadi lebih menarik.

    Jadi sangatlah jelas bahwa peran motivasi sangatlah tingginpenaruhnya terthadap knnerja seseorang. Apabila pegawai telah memiliki motivasi untuk belajar diharapkan ia pun memiliki motivasi yang tinggi untuk bekerja dam memberikan kontribusi terbaiknya bagi perusahaan.

    By : Evita Ardhyana
    Tugas individu PSDM
    TP UNJ

  6. 8 Hamdi gunawan UNPAK PASCA June 8, 2008 at 2:23 pm

    Assalalmualaikum bapak……
    Jika membaca tulisan bapak, ternyata motivasi sangat menentukan kinerja seseorang namun secara mendetailnya mohon seberapa signifikan keberhasilannya itu dan bagaimana faktor lingkungan dan organisasi belajar terhadap kinerja pegawai apakah signifan atau tidak terhadap kinerja orang?
    makasih pak..

  7. 9 A.S. Widyarto June 9, 2008 at 7:45 am

    Salam kenal, Pak.

    Saya bertugas untuk mengatur sebuah departemen yang rata-rata berisi SDM yang sudah tua. Kira-kira model motivasi apa yang harus saya terapkan? Persiapan-persiapan apa saja untuk membangun sistem tersebut?
    Terim kasih.

    A.S. Widyarto

  8. 10 Rini Mulyani-Pakuan Bogor June 12, 2008 at 12:10 pm

    assalamualaikum wr wb…..
    P.adie membaca apa yang telah dituliskan bapak, rasanya sudah lebih dari lengkap. jadi ga ada yang harus dicomment kayanya. Tapi saya hanya mau bertanya ke bapak. Yach kita tau dan sadar bahwa motivasi memang sangat dibutuhkan bagi semua manusia yang masih mau berusaha. baik datangnya dari diri individu maupun dari luar individu, agar hasilnya nanti dapat optimal. kita tahu di EQ pun menurut Daniel Colleman Ph.d menyatakan bahwa 5 dasar kecakapan yang mempengaruhi emosi dan sosial yaitu kesadaran diri, pengaturan diri, Motivasi, Empati dan keterampilan sosial. lagi2 motivasi diperlukan ya pak. Nah kalau merujuk pada pengelompokkan manusia berdasarkan AQ ada kelompok yang disebut Quitters, Campers, dan Climbers. Seharusnya kita masuk pada kelompok Climbers (Amin….Mudah-mudahan).
    Tapi kembali pada realita yang ada sekarang ditengah kesulitan yang semakin kompleks rasanya orang sudah sangat sulit untuk menjadi kelompok Quitters saja, dalam hal ini dipaksa untuk puas. jadi sebesar apapun motivasinya kalau kesempatan berusahanya sudah sulit didapatkan maka saya rasa akan sulit orang tersebut meraih apa yang diinginkannya. saya jadi ingat obrolan saya dengan teman yang menyatakan bahwa orang miskin itu malas. saya tidak setuju pak. kita lihat saja pemulung yang ada di komplek rumah saya. tidak jarang dia mulai bekerja itu sebelum azan subuh berkumandang. ketika saya tanya itu harus dia lakukan karena kalau sedikit seja kesiangan maka akan terdahului oleh pemulung lainnya. Nach pada kasus ini berarti motivasi berusahanya kan sangat tinggi ya pak. (jelas terlepas dari tingkat pend yag dipunyainya). Jadi saya rasa motivasi itu pada setiap manusia ada hanya kadang lingkungan yang menyebabkan tinggi rendahnya motivasi qt. Oh ya jadi lupa pertanyaannya pak Apa sich fungsi motivator2 yang sekarang ini banyak bermunculan dengan tentu saja bayaran yang mahal…sedangkan yang saya lihat yang datangnya juga orang-orang yang sudah sukses di bidangnya masing2. (bukan cuma mau cari sensasi saja) seperti baru2baru ini tung……..siapa pak saya lupa yang menyebarkan uang dari udara di serang-Banten. Dia kan motivator no wahid tapi masih juga cari sensasi. apa dengan cara seperti itu termasuk memotivasi..
    Yah cuma itu mungkin pak kalau saya sich berharap ada langkah nyata yang diberikan oleh motivator tersebut untuk perbaikan mental anak negeri ini. OK terima kasih P.Adie
    Wassalamualaikum Wr Wb

  9. 11 madya surya (MMF UGM) August 4, 2008 at 1:46 am

    Salam kenal, Pak
    saya saat ini sedang melakukan penelitian untuk tesis yang kebetulan berkaitan dengan motivasi dan produktivitas kerja.saya minta tolong bagaimana model analisis yang cocok untuk penelitian ini, jika menggunakan model skala likert apakah cocok dan valid?

  10. 12 ipin November 12, 2008 at 3:45 am

    Yth bapak,
    Terima kasih untuk teori motivasinya. Mohon informasi tentang referensi peningkatan motivasi kinerja dalam Continuous Improvement Program melalui sistem “reward”.
    Sebagai bahan acuan tugas karya tulis.
    Sekali lagi terima kasih, ditunggu informasinya.

  11. 13 Hikmah Purnamasari February 23, 2009 at 1:16 pm

    pak, saya Hikmah Reguler TP 2007!!
    saya tertarik dgn tulisan motivasi ini..!!saya juga membenarkannya pak!!tapi pak, dari yang saya baca, kebanyakan kan motivasi datang dari luar, faktor-faktor yang mempengaruhi juga banyak!!nah pak, sbenarnya motivasi juga dari dalam diri kita kan pak??saya pernah dengar, motivasi yang paling utama adalah dari diri kita!!karena, walupun orang lain udh cape memotivasi, tapi kita sendiri gak mau bangkit, gak akan bangkit kan pak??nah, trus tuh gmana pak??
    solusinya pa pak??terima kasih pak..

  12. 14 yoga-uns May 19, 2009 at 1:39 am

    assalamualaikum wr. wb.
    pak,saya sangat tertarik dengan tulisan bapak mengenai motivasi ini.
    kalau tulisan bapak lebih banyak menyoroti hubungan motivasi karyawan dengan kinerja, bisakah saya minta tolong untuk dijelaskan hubungan atau pengaruh motivasi kerja terhadap percaya diri karyawan dalam belajar dan mengembangkan kemampuan yang berkaitan dengan pekerjaannya?
    terima kasih pak?

  13. 15 Ibu Leony, NTT May 30, 2009 at 2:54 am

    Selamat Siang Pak!
    Pak, saya terterik dengan tulisan bapak mengenai motivasi.
    Saya mau penelitian tentang faktor-faktor organisasional dimana meliputi faktor komitmen, motivasi dan kepemimpinan kaitannya dengan kinerja.
    bisakah saya dapat dijelaskan pengaruh ketiga faktor tersebut dengan kinerja?
    Sebelumnya saya ucapkan terima kasih pak!
    Kalau tidak keberatan bapak balas melalui mail saya.

    • 16 Performance Tech Adie June 2, 2009 at 2:46 am

      Yth Bu Leony
      Ketiga variabel tersebut tentu memiliki korelasi. Hanya saja Ibu perlu menentukan variabel terikat dan varibel bebas. Motivasi baik internal atau eksternal pada dasarnya dapat dijadikan salah satu faktor penentu atau variabel bebas. Demikian, sukses untuk ibu Leony



    • 17 Performance Tech Adie July 10, 2009 at 1:19 pm

      Komitmen. motivasi dan kepemimpinan tentu secara teoritis memiliki korelasi dengan kinerja. Sedangkan yang perlu diteliti seberapa signifikan korelasinya. Teima kasih.

  14. 18 frans pontoh June 12, 2009 at 2:04 am

    saya seorang mahasiswa UGm yg sedang merevisi skripsi.
    pertanyaan saya apakah ada teori HErzberg yang menjelaskan pengaruh masing-masing faktornya dengan kinerja.
    terimakasih tolong diberikan informasi

  15. 19 ihkwan June 26, 2009 at 4:54 pm

    menurut sy “motifasih merukan kekuatan yang harus diberikan kepada karyawan khususnya, dan masyarakat pada umumnya sebab dasar loyalitas dalam mencapai misi tertentu atau misi pada umunya akan sangat di butuhkan sebagai dasar penggerak bagi kayrawan.
    serta kaitanya dengan peningkatan kinerja karyawan maka akan sangat dominan pengaruhnya sebagai alasan dasar adalah eksplorasi dan ekspresi diri dipengaruh dari tingkat kebutuhan dasar manusia yaitu prestise, sedangkan prestise merupakan elemen yang terdapat pada motivasi

  16. 20 ihkwan June 26, 2009 at 4:57 pm

    maap pak salam kenal dari sy, dan terima kasih atas karyanya sehingga saya dapat meningkatkan pengetahuan saya terlebih untuk konteks motifasi

  17. 21 youdi amin July 8, 2009 at 12:04 pm

    Pak saya lagi nyelesaikan skripsi saya,saya bisa minta tolong dikirimi artikel atau literatur mengenai motivasi dipengaruhi oleh 3 faktor.a.faktor psikologi b.faktor fisiologi c.faktor lingkungan.

  18. 22 indri nadia September 12, 2009 at 11:09 pm

    Mksiih y pak buat tulisan nya.
    sungguh membantu saya dalam menyelesaikan tugas membuat buku.

  19. 23 hiron gaputra October 12, 2009 at 12:05 pm

    selamat malam pak, sy sudah membaca tulisan bapak mengenai motivasi. Tulisannya sangat menarik membuat saya tidak pernah bosan untuk membacanya. Pak, saya mahasiswa smester akhir yang kebetulan lagi menyusun skripsi. Judul skripsi saya ” PENGARUH MOTIVASI DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN ” Dalam menyusun skripsi ini saya sedikit menemukan kesulitan mengenai faktor-faktor yang mempengaruhi variabel2 tersebut karena faktor2 inilah nantinya yang akan menjadi alat ukur dalam analisis data yang saya gunakan. Mohon bantuannya pak, terima kasih sebelumnya. Wassallam

  20. 24 Munir Al Misbach March 8, 2010 at 6:27 am

    Salam kenal Pak dari saya.
    Tulisan Bpk, Bagus n saya terima kasih bgt atas tulisan ini karena membantu saya dalam pengerjaan tugas akhir saya.sekali lagi terima kasih banyak ya Pak???

  21. 25 ipang March 19, 2010 at 9:28 am

    trimakasih ya pak.

  22. 26 Moh. Hasan Asari May 15, 2010 at 4:18 am

    Terimakasih pa adie, saya banyak mendapatkan banyak pengetahuan. saya juga mohon bantuan mengenai Pemanfaatan IT dari sisi isu-isu etika yang muncul dimasyarakat tentang minimalisasi dampak penggunaan IT.

    Mahasiswa S3 UNPAK

  23. 27 erbypratama October 7, 2010 at 11:25 pm

    yang terhormat pak adie, memang yang sulit sekali adalah memecahakan permasalahan intrinsik motivasi atau juga biasa disebut motivasi intrinsik yang datangnya berasal dari dalam diri, kadang ketika motivasi intrinsik meningkat, lingkungan menjadi hal yang bisa menurunkan motivasi itu, tapi bapa sudah menjelasakan adanya pendekatan – pendekatan yang bisa mengatasi turunnya motivasi. terimakasih pak.

    Erby Pratama Putra/A.I.I/072110010
    MP UNPAk

  24. 28 katrin kaniawati October 16, 2010 at 12:45 pm

    motivasi ternyata merupakan “sosok” yang paling berperan dalam segala hal.terima kasih untuk karya yang bapak buat,,sehingga saya termotivasi juga untuk menikmati pekerjaan saya walaupun di tempat yang menurut orang merupakan daerah terpencil”

  25. 29 cesilia isbandiah November 7, 2010 at 1:48 pm

    ass. pak saya mahasiswi magister manajemen sedang menulis tesis tentang pengaruh manajemen keterbukaan kepala sekolah terhadap motivasi dan kinerja guru, tapi saya kesulitan untuk memdapatkan literatur yang berkaitan dengan motivasi dan kinerja yang lengkap boleh dong saya dibantu pak….

    • 30 Performance Tech Adie November 8, 2010 at 2:17 am

      Assalam wr
      Saya siap bantu, mhn lebih spesifik apa yg dimaksud dh manajemen keterbukaan. Apakah transparansi atau MBS. Tks Wass. Adie

  26. 33 December 15, 2011 at 5:21 am

    Saya Ahmad Qabil, Mahasiswa Ekonomi Manajemen.cara menghitung pengaruh motivasi terhadap kinerja menggunakan Rumus regresi,gimana penguraiannya…pak.??

  27. 34 dhan December 19, 2011 at 1:14 pm

    mf mhon bntuannya, bsa krimin sya tentang indikator motivasi seperti :
    Tanggung jawab
    Semngat kerja

  28. 35 Zozolino January 3, 2012 at 7:32 am

    Helo, Selamat hari Natal dan Tahun Baru.
    Bolekah bapak membantu saya dalam skripsi yang berjudul ” Pengaruh Motivasi Terhadap Produktivitas Kerja Pegawai”, kalau boleh tolong bapak berikan jawaban dan biaya akan saya tangguung.
    terima kasih atas kerja samanya.

  29. 36 selly April 26, 2012 at 2:10 am

    bagus buat nyusun skripsi saya,trima kasih pak

  30. 37 mujihastuti May 13, 2012 at 3:25 am

    terima kasih pak. materinya bagus.sangat menolong untuk .referensi bahan tesis .masalah yang kami angkat kapabilitas,beban kerja dan organisasi kaitannya motivasi kerja dan kaitannya kinerja/ tolong bantu kami judul buku apa yang relevan dg masalah yang kami angkat.sehinnga kami bisa jadikan referensi dan kami cari ditoko buku/ terima kasih [pak. sebelumnya tolong bakas lewat enail mkami ya pak.

  31. 38 Endro May 17, 2012 at 12:34 am

    Ass Wr Wb.
    saya tertarik dengan tulisan bapak, ada beberapa pertanyaan saya yaitu:
    1. bagaimana kita membangun hubungan motivasi dengan gaya kepemimpinan.
    2. bagaimana membangun hubungan motivasi dengan emosional seseorang sehingga kita dapat memanfaatkan secara efektif,
    3. bagaimana membangun hubungan antara konsep motivasi dan konsep kinerja sehingga secara teori dan empiris, kita dapat menjelaskan hubungan tersebut
    Wassalamu’allaikum wr wb.

  32. 39 lovakawai June 13, 2012 at 5:38 pm

    selamat malam
    pak, saya mahasiswi skripsi yang memilih motivasi sebagai variabel kontrol antara iklim komunikasi dalam organisasi dalam pengaruhnya terhadap kinerja karyawan, besok senin saya sidang, dan satu pertanyaan yang belum terjawab adalah apakah alasan saya dalam memilih motivasi sebagai variabel kontrol, karena di buku yang saya baca, motivasi memang mempengaruhi kinerja, saya membutuhkan buku literatur yang menyatakan bahwa motivasi kerja merupakan faktor pengaruh paling signifikan terhadap kinerja, sehingga saya bisa menjawab pertanyaan penguji mengenai alasan saya menggunakan motivasi sebagai variabel kontrol.
    juga mengenai perumusan Kinerja = f ( Motivasi x Kompetensi x Kesempatan ) mohon untuk dibantu literaturnya pak

    mohon bantuannya pak, terimakasih.



  33. 40 Nurul Hikmah Mawaddah June 15, 2012 at 4:55 am

    selamat siang Pak,
    saya Nurul Hikmah M. mahasiswa smt 4 Jurusan Teknik Informatika Binus University. Sesuai tugas yang bapak berikan dalam mata kuliah CB : Interpersonal development untuk mengomentari mengenai pengaruh motivasi. Menurut saya, motivasi sangat penting bagi setiap orang. untuk mencapai tujuan yang diinginkan seseorang harus mempunyai motivasi yang besar. Orang yang tidak memiliki motivasi akan mengalami kesulitan untuk mencapai tujuan dan kesuksesan. motivasi biasanya didapat dari lingkungan keluarga, teman, dosen maupun lingkungan sekitar. motivasi merupakan dorongan dalam diri manusia untuk menentukan sikap atau perilaku yang harus dilakukan.

    Terima Kasih

    • 41 Performance Tech Adie June 20, 2012 at 1:46 pm

      Dear Binusian
      Thank you for your responds regarding motivation. Kita tahu bahwa motivasi bisa secara intrinsik dan ekstrinsik. Motivasi ektrinsik seperti upah, fasilitas dan kebutuhan dasar lainnya relatif bersifat jangka pendek. Sedangkan motivasi intrinsik seperti prestasi, tantangan, karya inovasi dll. akan berdampak jangka panjang. Masalahnya bagaimana kita membangun motivasi intrinsik agar lebih maju dan berhasil.

  34. 42 sriwulan99 September 16, 2012 at 1:29 pm


    Pak Dosen, saya Sri Wulan Mahasiswi smt 1 Pasca AP.Tema tentang ” Pengaruh Motivasi terhadap peningkatan Kinerja ” yang Bapak sajikan sangat relevan dengan kenyataan yang ada di dunia kerja saat ini, dimana tiap orang yang disadari atau tidak dalam dirinya sudah terbentuk pola prilaku kerja “asal bos senang” atau bekerja jika ada yang “mengawasi” jadi minimnya loyalitas dan rasa tanggung jawab atas kepercayaan yang diberikan oleh atasan. Pada umumnya kebanyakan hanya berfikir semua adalah beban, sehingga itu hanya akan menjadi rutinitas harian, yaitu berangkat pagi pulang petang. Jika hal tersebut dibiarkan kelak akan membuat orang tersebut timbul titik jenuh, bosan, mengeluh, dan kinerja yang terus menurun.

    Penting nya motivasi dalam diri, berkerja dengan tim, bisa membuat dirinya sadar akan keberadaannya sebagai makhluk sosial yang tidak bisa hidup sendiri tanpa ada kerjasama, interaksi dengan orang lain. Jadi meskipun
    perusahaan yang sudah memenuhi hierarki kebutuhan yang dipaparkan menurut Abraham Maslow, jika dalam diri orang tersebut sudah tertanam prllaku diatas, tidak menutup kemungkinan maka akan semakin banyak manusia “gagal” dalam hidup.

  35. 43 zaenal abidin September 16, 2012 at 3:08 pm

    Motivasi memang obat jiwa dalam melaksanakan aktivitas dilingkungan kerja bahkan anak2 atau peserta didik lebih senang jika kita motivasi dan memberikan penghargaan jauh sekali dengan anak yang berada didalam tekanan begitu juga lingkungan kerja.
    Dan terkadang motivasi ini yang kerap kali jarang dan bahkan sedikit yang datang dilingkungan kerja.
    by Zaenal Abidin
    class A.1.1

  36. 44 nurdin September 19, 2012 at 8:20 am

    Assalamualaikum Pak Adie
    Sebelumnya terimakasih atas artikelnya Pak, saya jadi lebih sadar sebagai karyawan kini saya berada di koridor yang mana menyikapi masalah motivasi kerja yang terjadi di lingkungan kerja saya
    Menurut persepsi saya motivasi setiap karyawan tergantung dari tujuan yang ingin dicapai oleh karyawan itu sendiri pak. Tidak sedikit dari para karyawan yang terkadang memiliki kebiasaan datang, isi absen, kerja dan pulang. Namun bagi sebagian karyawan yang memang memiliki motivasi tinggi terhadap profesinya, mereka akan menjadikan pekerjaannya sebagai wahana untuk memperkaya kreasinya, kondisi lingkungan kerja yang nyaman akan membuat karyawan bisa lebih imajinatif dan kreatif dalam menjalankan pekerjaannya. Mengutip materi yang bapak tulis bahwa salah satu faktor yang akan sangat mempengaruhi terciptanya lingkungan kerja yang kondusif adalah kebijakan perusahaan dan sistem administrasinya, gaya kepemimpinan serta kondisi lingkungan kerja (Teori Hygine Herzberg) dengan kata lain, bahwa Kebutuhan dihargai sebagai manusia ternyata lebih penting dalam meningkatkan motivasi dan produktivitas kerja karyawan dibandingkan dengan kondisi fisik lingkungan kerja. (Teori Efek Hawthorn).
    Nurdin (A 1-1) (

  37. 45 Yedi Firman September 19, 2012 at 4:05 pm

    Salam kenal pak adie
    Bisa dikatakan salah satu faktor yg mempengaruhi peningkatan kinerja adalah motivasi. Selain bermanfaat ntuk diri sendiri, hal tersebut juga berpengaruh untuk lingkungan sekitar kita.
    Seperti contoh ditempat saya bekerja, seorang guru yang mempunyai kinerja baik biasanya didukung oleh kemampuan dan motivasi tinggi. Guru yang mempunyai kinerja baik akan peduli terhadap siswanya dan akan memberikan perhatian/motivasi yang dapat menumbuhkan semangat belajar siswa agar lebih baik. Sehingga kualitas pembelajaran akan meningkat. Begitu pula sebaliknya, guru yang mempunyai motivasi rendah akan mengurangi kinerjanya dan akan bersikap acuh terhadap siswanya.
    By. Yedi Firman
    PPS-AP UNPAK Kelas A.1.1

  38. 46 Usep Rizab September 19, 2012 at 5:13 pm

    Jika dianalisis secara lebih mendalam motivasi merupakan dorongan yang timbul dalam diri seseorang sehingga memberikan energi yang positif untuk mampu menimbulkan suatu sumberdaya yang tidak tak terbatas. Motivasi membentuk seorang karyawan untuk mampu mengekspresikan dirinya menjadi lebih baik, hal ini dikarenakan motivasi mampu membangun tidak hanya sekedar sebuah tanggungjawab pekerjaan yang harus diselesaikan atas perintah atasan tapi dengan motivasi tanggungjawab tersebut diubah menjadi sebuah kebutuhan dalam meningkatkan etos kinerja, sehingga bisa diasumsikan motivasi tinggi mampu mendorong kinerja yang tinggi pula.

    Dilihat dari 5 teori yang sampaikan, pada prinsipnya dari kelima teori tentang motivasi terdapat persamaan yaitu adanya faktor-faktor ekstrinsik dalam diri seseorang yang menyebabkan timbulnya suatu motivasi. Selain itu faktor kebutuhan menjadi landasan lainnya yang menyebabkan tumbuhnya suatu motivasi untuk mampu melakukan pekerjaan dengan baik agar memperoleh pengakuan baik dari lingkungan pekerjaannya maupun lingkungan luar pekerjaannya, seperti teori dari Maslow dimana motivasi mampu memenuhi kebutuhan secara fisiologis sampai pengaktualisasian diri

    Tetapi kadangkala motivasi naik dan turun sesuai dengan kondisi seseorang seperti bad mood, kondisi keluarga, lingkungan pekerjaan dan lainnya, namun hal itu adalah wajar adanya, yang perlu ditekankan dalam mengatasi perubahan naik turunnya motivasi ataupun termotivasi dengan motivasi buruk akibat terprovokasi oleh lingkungan sekitarnya adalah upaya penyadaran diri dengan melibatkan atasan dan teman sejawat untuk kembali memberikan pencerahan motivasi sehinggai pola pikirnya kembali segar.

    NPM : 072112089
    KELAS A1.1

  39. 47 seftian zaenal muharram September 20, 2012 at 2:41 am

    aslmkum…. pa.. kalau ada karyawan yg tahu tentang teori X & Y.. mungkin dia akan selalu waspada… apalagi kalau dihubungkan dengan kebutuhan.. kalau dia tahu bahwa kebutuhan yg tidak terpenuhi itu menyebabkan ketegangan,, mungkin dia akan beranggapan untuk apa dia bekerja, kalau seandainya kerja menyebabkan ketegangan… untuk itu motivasi bagi mereka sangat diperlukan..
    terima kasih..
    seftian zaenal muharram,
    administrasi pendidikan
    kelas A.1.1

  40. 48 Estrid Sutanti September 20, 2012 at 3:29 pm

    Assalamualaikum wr .wb

    Motivasi yang menunjukkan kebutuhan yang tidak terpuaskan, akan meningkatkan tegangan dan memberikan dorongan pada seseorang dan menimbulkan perilaku. Dengan asumsi faktor internal dan eksternal mempengaruhi pergerakan individu dalam pecapaian motiv. Aplikasi motivasi dalam melaksanakan pekerjaan miliki peranan seberapa besar pergerakan yang di usahakan dalam proses kerja. Kontradiktif dengan kondisi seseorang yang berada dalam zona nyaman (comfort zone) kecendrungan motivasi bisa menurun.

    Estrid Sutanti (A.P UNPAK) Class A. 1.1

  41. 49 chidayat September 20, 2012 at 11:36 pm

    saya setuju dengan apa yang Dr H Adie.e yusuf,SPd.MA tulis, bahwa untuk
    meningkatkan kinerja suatu perusahaan maka karyawan perlu di dorong dengan motivasi agar tujuan dari suatu perusahaan dapat tercapai.
    Dalam kaitannya dengan dunia pendidikan juga pun demikian perlu adanya motivasi belajar dan mengajar yang tinggi baik dari pendidik maupun yang di didikyang pada nantinya tujuan dari bangsa ini yang salah satunya adalah untuk mencerdaskan kehidupan bangsa dapat tercapai

  42. 50 September 22, 2012 at 12:41 pm

    Assalamualaikum Wr. Wb…Terima kasih pak Adi yang sudah memotivasi kami untuk rajin membaca melalui sarana artikel yang bapak sajikan.

    Pak Adi Yth…Dari teori Abraham Maslow diatas diuraikan bahwa manusia memiliki motivasi karena didorong oleh adanya kebutuhan-kebutuhan dari kebutuhan fisiologis, kebutuhan akan rasa aman, tentram, kebutuhan untuk dicintai dan disayangi, kebutuhan untuk dihargai, kebutuhan untuk aktualisasi diri. Artinya menurut teori Maslow setiap individu baru akan melakukan pekerjaan terbaiknya jika semua kebutuhan secara maksimum terpenuhi. Memang dalam realita banyak ditemui mandegnya profesionalitas karena kurangnya motivasi karena kurangnya motivasi akibat tidak terpenuhinya kebutuhan dasar.

    Berkaitan dengan pernyataan Maslow..saya ingin mengomentari…..jika kita kaitkan dengan profesi kita sebagai guru profesional.apakah kebutuhan tentang harga diri harus menunggu kebutuhan fisik dan aman terlebih dahuhu ?? Bagaimana jika hierarki teori Maslow tersebut dibalik ?? Karena setiap individu dari tingkatan apapun harga diri…pasti ditempatkan sebagai unsur utama , tentu yang diharapkan bukan karena kebutuhan dasar/fisik belum terpenuhi lantas kita mengorbankan harga diri dan keinginan untuk aktualisasi diri.

    Jika kita kaitkan dengan konsep Islam dalam QS Al Anam !62-163 ” Sesungguhnya sholatku ibadahku , hidupku, matiku hanyalah untuk Allah semata. Tiada sekutu bagiNya dan demikian yang diperintahkan kepadaku dan aku adalah orang pertama yang menyerahkan diri kepada Allah. Ayat tersebut menggambarkan dengan jelas bahwa segala aktivitas seorang muslim seharusnya didasari atas motivasi pada pencapaian untuk Allah SWT…Sehingga dengan kata lain aktualisasi diri sesungguhnya bisa dilakukan kapan saja untuk memerankan siapa diri kita sesungguhnya..

    Sebagai guru profesional motivasi dan kemauan untuk aktualisasai diri sangat dibutuhkan agar tidak tersingkir akan kemajuan zaman.. dan harapnya tentu tidak mungkin jika pada akhirnya berpengaruh terpenuhinya kebutuhan fisik kita selanjutnya..Karena dalam Firman Allah dala QS Ar Raad 11 : juga dijelaskan bahwa Allah Tidak akan mengubah nasib suatu kaum jika kita sendiri tidak mengubahnya….


    Lies Rahmawati AP class A1.1 ( NPM :072112073)

  43. 51 Desi Trisnawati October 7, 2012 at 9:35 am

    Assalamu’alaikum wr.wb
    Salam kenal buat pak Adie . . . .
    sangat menarik tulisan Bapak tentang ” Pengaruh Motivasi dalam Peningkatan Kinerja”. saya sependapat dengan Bapak bahwa motivasi dapat meningkatkan kinerja yang tinggi. motivasi tidak hanya muncul dari dalam diri seseorang, tetapi juga dari luar. ketika kita dapat memadukan kedua motivasi tersebut, saya yakin kinerja kita akan lebih baik lagi. saya sebagai seorang pendidik dapat merasakan hal tersebut. semangat bekerja, berpikir positif, keluarga, dan siswa yang memotivasi saya untuk selalu lebih baik dari hari ke hari. motivasi yang baik membuat kita lebih bijak dalam bersikap, bertindak dan berpikir. satu hal yang paling penting, Allah SWT selalu mengawasi semua perbuatan kita, sehingga kita memiliki kontrol diri , motivasi yang tinggi serta bekerja lebih baik lagi. jadikan apa yang kita lakukan sebagai ladang ibadah dengan niat yang ikhlas.
    Demikian yang dapat saya sampaikan. Terima kasih

    Desi Trisnawati
    Mahasiswi Smt 1 Pasca Sarjana UNPAK
    Administrasi Pendidikan
    NPM : 072112177

  44. 52 ekarostika October 8, 2012 at 9:18 am

    Eka Rostika
    kelas E.10
    Assalamu’alaikum pak Adie
    Status saya adalah kepala sekolah di sebuah TK yaitu Taman Kanak – kanak di Parungkuda yang mana saya membimbing guru dan siswa TK, benar sekali pak Pengaruh motivasi ini dalam peningkatan kinerja sangat berperan sekali dan sudah saya rasakan baik terhadap guru maupun siswa bisa dilihat dan dibandingkan ketika guru yang termotivasi untuk bekerja dan guru yang kurang termotivasi baik dari luar maupun dari dalam maka hasilnya akan berbeda, begitu juga bagi para siswa TK walaupun motivasinya bukan untuk bekerja tapi dalam bermainpun ( karena pembelajaran di TK itu adalah prisipnya bermain sambil belajar dan belajar seraya bermain ) akan sangat terlihat sekali siswa yang termotivasi dan yang tidak dan itu adalah tugas guru TK untuk memotivasinya.
    Demikian pak komentar saya semoga bermanfaat,walaupun saya sebagai Kepsek TK tetapi sy selalu termotivasi dengan istilah long life education untuk selalu meningkatkan wawasanTerima kasih

  45. 53 winirismayanti October 9, 2012 at 1:24 pm

    Assalamualaikum Wr Wb

    hello sir, it’s nice to know you…

    Pertama-tama, saya mau mengungkapkan dulu tentang mata kuliah psikologi pendidikan dan pembelajaran. Honestly, I’m really interested in this subject, karena saya merasa hal tersulit menjadi seorang guru adalah menjadi seorang MOTIVATOR. kenapa? karena sangat sulit membangun motivasi internal dalam diri siswa untuk mau belajar. Oleh karena itu, saya sangat antusias dengan mata kuliah ini. Mudah-mudahan saya bisa mendapatkan pengalaman yng luar biasa setelah belajar mata kuliah ini.

    Terkait dengan materi di atas, saya merasakan bahwa motivasi itu hal terpenting dalam hidup manusia, baik motivasi internal ataupun eksternal. hal yang tersulit meningkatkan motivasi adalah motivasi internal atau keberadaan virus mental dalam dirinya.. karena apabila seseorang memiliki motivasi intrenal yang baik dalam dirinya, akan sangat mudah untuk bisa meningkatkan kinerja.

    that’s all my opinion Sir,
    thank you very much,,


    Wini Rismayanti
    NPM 072112209
    Mahasiswa PPs UNpak Adpen 2012-2013 kleas E.10
    my Blog WINI winirismayanti,

  46. 54 eka rostika October 9, 2012 at 2:10 pm

    Assalamu’alaikum…..pak Adie
    Salam hormat dan salam kenal………………..
    Motivasi memang sangat dibutuhkan dalam meningkatkan kinerja, begitu juga bagi guru yang sehari harinya menghadapi siswa kalau tidak termotivasi maka akan berdampak pula pada keberhasilan siswa dan saya sangat setuju sekali dalam memotivasi kerja itu dengan teknik Komunikatif Persuasif yaitu teknik mempengaruhi dari luar diri yang terkenal dengan rumus ADIDAS jadi selain dari dalam diri biasanya guru juga membutuhkan motivasi dari luar
    Demikian pak sedikit commet dari saya . Terima kasih
    Eka Rostika
    Mhsswa Smstr 1 Pasca UNPAK kelas E.10
    NPM : 072112179

  47. 55 Komalasari October 10, 2012 at 10:57 pm

    Selamat pagi Pak Adi,
    Saya telah membaca seluruh bagian dari tulisan bapak Pengaruh Motivasi terhadap Peningkatan Kinerja, semua menarik dan bermanfaat. Tapi ada bagian yang membuat saya merenung dan mengiyakan hampir semua point tersebut terjadi di lingkungan kerja saya. Ketika saya membaca tulisan bapak tentang Tanda-tanda karyawan yang termotivasi dengan buruk, saya merasa bebera dari ciri2 diatas ada pada sebagian dari kami. Tidak sedikit dari kami yang Tidak bersedia bekerja sama, Tidak mau menjadi sukarelawan, Sering datang terlambat, pulang awal dan mangkir tanpa alasan, Memperpanjang waktu istirahat berbincang-bincang (ngobrol) , Tidak menepati tenggat waktu tugas, tidak mengikuti standar yang ditetapkan, selalu mengeluh tentang hal sepele, saling menyalahkan, tidak mematuhi peraturan. Dan untungnya bapak memberikan cara memotivasi kerja teknik komunikasi persuasif dan antisipatif. Saya pribadi akan melakukan semua itu yaitu: perhatian yang penuh pada perubahan apa yang seharusnya anak-anak dapatkan, hasrat/keinginan yang membara: ingin cepat2 melihat siswa kita mampu melakukan hal –hal baru, minat dan kepentingan: mereka akan curious untuk belajar, keputusan yang tepat, tindakan nyata dan kepuasan atas hasil yang dicapai terakhir berpikir positif terhadap pekerjaan. Mungkin point-point itu akan saya bicarakan pada atasan saya untuk perubahan etos kerja menjadi lebih baik. Terimakasih Pak.
    Komalasari, administrasi Pendidikan S2 , kelas sukabumi E 10

  48. 56 Iswah Ismatullah October 12, 2012 at 2:13 am

    Assalamualaikum Wr.Wb.

    Selamat pagi pak. Saya Iswah mahasiswa PPs kelas E.10. Setelah saya membaca tulisan bapak ada satu hal yang menarik. Hal tersebut adalah bahwa motivasi itu sangat berpengaruh terhadap kinerja seseorang dalam melaksakan segala sesuatu, baik dalam bekerja maupun belajar. Kaitannya dalam bekerja, faktor internal sangat penting untuk kelangsugan karier seseorang dalam bekerja, karena tidak sedikit orang yang sulit termotivasi dalam malakukan sesuatu.

    Oleh karena itu, peran seorang leadher sangat dibutuhkan agar sesorang dapat termotivasi. Peran tersebut dapat tercermin dengan mencipatkan lingkungan kerja yang nyaman, membina koordinasi yang baik dengan bawahan dan tumbuhkan sikap saling menghargai antar sesama karyawan.

    Untuk sementara mungkin itu komentar yang dapat sampaikan, mudah-mudahan dapat bermanfaat untuk kita semua. Amiiin.
    Wassalamualaikum Wr. Wb

  49. 57 Yani Nurcahyani October 17, 2012 at 1:17 am

    Assalamu’alaykum Pa Adie….
    Saya mahasiswa bapak PPs UNPAK….
    Subhanalloh… inspiratif banget tulisan bapak, di kala motivasi dan kinerja pada saat ini menjadi pertanyaan besar bagi kaum pendidik,,, seakan mengingatkan saya sebagai pelayan masyarakat…Ketika predikat guru diangkat dengan adanya UU No. 14 Tahun 2005 (Tunjangan Profesi Guru/ Sertifikasi) apakah motivasi dan kinerja guru dijamin meningkat? Mudah-mudahan kenyataan di lapangan semua pendidik amanah dalam menjalankan tugasnya..
    Islam menyukai pekerjaan yang dilaksanakan secara profesional. Sebagaimana dalam kutipan: “Bekerjalah kalian dengan sungguh-sungguh niscaya Alloh dan Rasul akan melihat(pekerjaanmu)”,
    “Setiap kamu adalah pemimpin dan akan mempertanggungjawabkan apa yang dipimpinnya”.
    Apabila kita sebagai orang beriman, kita akan melaksanakan pekerjaan kita dengan sebaik-baiknya karena di akhirat akan dipertanggungjawabkan. Kinerja dan motivasi erat kaitannya dengan ibadah. Apabila kita telah sadar bahwa pekerjaan ini ibadah, maka motivasi dan kinerja yang baik akan terwujud.
    Mungkin itu tambahan aja… Mudah-mudahan kita termasuk orang-orang yang amanah dalam menjalankan tugas… Aaamiin.
    Makasih Pa Adie…
    Wassalamu’alaykum wr.wb

  50. 58 dede pramulyana October 19, 2012 at 2:37 am

    Assalamu’alaikum wr.wb

    Salam kenal untuk Pak Adie
    Setelah saya membaca dan mencoba untuk memahami, ternyata Motivasi ini sangat dan perlu dimiliki oleh semua orang,khususnya bagi saya sebagai seorang pengajar agar bisa menjadi seorang pengajar yang lebih profesional. Dalam tunututan kerja banyak rintangan yang pasti di hadapi, salah satunya, bagai mana cara kita memotivasi diri kita sendiri. Dari beberapa teknik yang di paparkan oleh Pak Adie, menurut saya Teknik Pemenuhan Kebutuhan yang sesuai untuk memotivasi diri kita sendiri. Karena pada hakekatnya seseorang bekerja untuk memenuhi kebutuhannya, jika semua kebutuhan tersebut terpenuhi maka kinerjanya pun akan meningkat. Selain itu peranan atasan dalam hal ini kepala sekolah sebagai seorang Motivator, juga turut andil dalam menjaga motivasi kita agar tidak turun.
    Mungkin Hanya ini komentar yang bisa saya berikan,semoga ada manfaatnya.

    Wassalamu’alaikum wr. wb

    Dede Pramulyana
    NPM : 072112176
    Kelas : E.10
    Mahasiswa Semester 1 Pascasarjana UNPAK 2012

  51. 59 gentra October 20, 2012 at 8:19 am

    Assalamualaikum .Wr.Wbr.
    Saya Sukandi Setiabudi Mahasiswa Pasca Sarjana Semester 1 Jurusan Adminitrasi Pendidikan Kelas E.10 asal Sukabumi.
    Saya ucapkan terima kasih Pak, Bapak telah memaparkan tulisan tentang Motivasi Kinerja.
    Tulisan yang Bapak paparkan tersebut , sangat bermanfaat dan memberikan pencercahan pada saya. Yang tadinya agak bingung bagaimana seseorang pimpinan memberikan motivasi kerja kepada bawahan.Betul sekali Pak, bahwa kita sebagai pimpinan, jangan sampai salah tindakan kepada bawahan. Seorang pimpinan harus mengetahui bagaimana situasi kondisi indinvidu bawahan .Dalam hal ini paparan Bapak yang menggugah hati saya adalah tentang Teknik dan pendekatan motivasi kerja. Apabila kita salah teknik dan pendekatan kepada bawahan maka resfonnya bukannya positif , justru akan negatif. Seorang pimpinan bukan segala-galanya mempunyai kekuasaan, kebijakan dan gila hormat. Saya kira , individu dapat bekerja dengan tenang, aman senang , harus adanya motivasi positif dari pimpinan. Mungkin itu saja Pak, tanggapan saya. Maaf bila tanggapan ini kurang berkenan.

  52. 60 Purba Saputra October 20, 2012 at 4:18 pm

    Assalammu’alaikum Wr.Wb.
    Setelah membaca artikel yang bapak posting, saya tertarik dengan “cara mengatasi penurunan motivasi” dengan pendekatan kuratif. Menurut pendapat saya suatu pendekatan sangatlah penting dalam menciptakan suatu kinerja yang betul-betul solid, akan tetapi dalam pendekatan ini seolah-olah penekanannya hanya pada karyawan saja dan untuk menjalankan pendekatan seperti ini, bukan hal yang begitu mudah. Karena cenderung antara atasan dan bawahan terdapat kesenjangan dalam berbagai segi, ambil satu contoh kesenjangan sosial; seorang atasan rata-rata memiliki sikap yang cenderung menonojolkan otoritasnya saja dan tidak dapat memperlihatkan familiar terhadap bawahan. Imbasnya dengan kondisi seperti itu, seorang bawahan akan merasa tidak nyaman dengan sikap atasan tersebut. Sehingga begitu jelas sebuah motivasi tidak akan tercipta. Jadi pada dasarnya suatu kinerja akan meningkat apabila seorang atasan yang mampu cepat membaca kondisi suatu perusahaan, dan mengawali untuk melakukan pendekatan ini. Sedangkan untuk pendekatan antisipatif, mungkin hanya akan terjadi pada beberapa gelintir bawahan/karyawan dalam satu perusahaan.

    Purba Saputra

  53. 61 Rika Opsari PRS October 21, 2012 at 8:23 am

    Assalamualaikum wr wb..,
    Salam kenal Pak Adie,,,

    Saya Rika Opsari, mahasiswa semester satu Pps Unpak kelas E.10. Saya sangat terkesan setelah membaca tulisan bapak, tetapi jujur, saya juga merasa “tertampar” ketika saya membaca bagian “Tanda-tanda Karyawan Yang Termotivasi dengan Buruk”. Ternyata sebagian dari tanda-tanda tersebut ada dalam diri saya, bahkan di lingkungan kerja saya. Saya menjadi sadar bahwa semakin banyak kita tahu, semakin luas pengetahuan yang kita dapatkan, maka semakin kita menyadari kelemahan-kelemahan yang ada didalam diri kita. Tapi saya termasuk orang yang beruntung karena bisa membaca tulisan-tulisan bapak, sehingga saya bisa memperbaiki diri dengan beberapa teknik memotivasi kerja dan cara-cara mengatasi penurunan motivasi, tidak hanya untuk saya pribadi,bahkan akan saya tularkan kepada rekan kerja dan peserta didik saya agar tercipta peningkatan kinerja guru dan prestasi peserta didik sehingga terwujud iklim kerja harmonis, berkualitas, dan berprestasi.

    Motivasi tidak hanya diperlukan untuk peningkatan kinerja, tetapi juga untuk peningkatan prestasi peserta didik. Istilah AMBAK (Apa Manfaatnya Bagiku ) bagi peserta didik, memunculkan rasa ingin tahu manfaat apa yang akan mereka dapatkan setelah mereka mempelajari materi bersama-sama dengan guru sehingga mereka lebih antusias untuk mengikuti pelajaran sehingga dapat meningkatkan prestasi.

    Mudah-mudahan kita semua bisa menjadi motivator yang baik untuk diri sendiri dan orang di sekitar kita, sehingga kita bisa menjadi manusia yang bermanfaat. Terimakasih Pak, karena membaca tulisan bapak wawasan saya menjadi semakin luas, semoga ilmu yang saya dapatkan dari bapak hari ini menjadi ilmu yang bermanfaat, Amiiinn.

    Rika Opsari PRS
    NPM : 072112202
    Kelas : E.10
    Mahasiswa Semester 1 Pascasarjana UNPAK 2012
    Jurusan Administrasi Pendidikan

  54. 62 A. Ismatullah October 21, 2012 at 8:36 am

    Salam Bp,

    Ni saya : A. Ismatullah (mahasiswa Pasca S2 Unpak Bogor)

    sangat tertarik dengan tulisan bapak tentang

    tiga macam kebutuhan yang dimiliki oleh setiap individu yaitu:

    · Kebutuhan berprestasi (Achievement motivation) yang meliputi tanggung jawab pribadi, kebutuhan untuk mencapai prestasi, umpan balik dan mengambil risiko sedang.

    · Kebutuhan berkuasa (Power motivation) yang meliputi persaingan, mempengaruhi orang lain.

    · Kebutuhan berafiliasi (Affiliation motivation) yang meliputi persahabatan, kerjasama dan perasaan diterima.

    dari tiga kebutuhan tersebut, kalau kbutuhan akan akan kerinduan kepada metafisika di posisi mana pa, sebab kebutuhan ini merupakan kebutuhan dasar yang ada pada setiap diri.

  55. 63 Mira Mariana Agustini October 23, 2012 at 10:03 pm


    Menanggapi ulasan motivasi untuk peningkatan kinerja, saya merasa sangat perlu diadakan pelatihan-pelatihan motivasi yang intensif bagi civitas akademi di tingkat pendidikan dasar maupun menengah, terutama bagi kepala sekolah dan kepala TU, hal ini saya rasakan di unit kerja saya, setiap hari, semua civitas akademi disibukkan oleh aktivitas yang benar-benar menguras pikiran dan tenaga, namun jarang bahkan kadangkala per bulan itu tidak pernah ada brieffing/support dari atasan yang memberikan kami motivasi, sehingga kami sering merasa “kok beban ini hanya ditanggung bawahan saja”. Mungkin benar merekapun sibuk bahkan lebih sibuk dari bawahannya, tapi bukankah seorang leader/manager yang baik adalah seseorang yang bisa membagi perhatiannya secara adil pada hak dan kewajiban yang diembannya?

    Saya sangat berterima kasih bila bapak berkenan membantu saya untuk memberikan pengarahan. Wassalamu’alaikum.

    Mira Mariana (E.10 PPs-Unpak)

  56. 64 PUJI NURANI October 25, 2012 at 1:19 am

    Assalamualaikum Pak Adhie …

    ini adalah kali keempat saya menulis komentar saya terhadap artikel ini. Tiga yang pertama belum berhasil, semoga kali ini berhasil, aamiin … :)

    Tak pelak lagi, image sebuah institusi sangat ditentukan oleh setinggi apa motivasi kerja yang ditunjukkan oleh para stake holder institusi tersebut.
    Sebuah institusi yang maju dan berkembang dengan pesat menunjukkan tingkat motivasi kerja stake holder yang tinggi, begitu pula sebaliknya.

    Motivasi kerja yang antara lain ditunjukkan oleh dedikasi dan loyalitas, memang tidak dapat serta merta diperoleh begitu saja. Harus ada stimulus positif agar motivasi kerja tersebut terus menunjukkan peningkatan kurva atau setidaknya konstan dalam level yang baik.

    Stimulus tersebut tentu sangat diharapkan datang dari pihak institusi, berupa penyediaan lingkungan kerja yang kondusif, hubungan antar personal yang sehat, perhatian terhadap kesejahteraan yang baik, dsb.
    Sementara stimulus dari dalam diri sendiri berupa positive thinking terhadap pekerjaan yang digeluti, dan pemahaman diri yang mendalam bahwa kerja adalah bagian dari ibadah, yang akan mendatangkan pahala jika dilakukan dengan ikhlas dan sebaik-baiknya, dan akan mendatangkan dosa jika melakukan pekerjaan secara serampangan saja.
    Stimulus dari dalam diri sendiri juga dapat diperoleh dengan lingkungan keluarga yang baik, hubungan keluarga yang harmonis, dsb

    Dengan demikian, Motivasi bukanlah harga mati atau sesuatu yang baku, melainkan sesuatu yang dinamis, dapat meningkat atau menurun, tergantung upaya apa yang dilakukan untuk mencapainya

    Artikel yang menarik, Pak Adhie ! I wish I’m gonna have such high level motivation in my work, aamiin …


    wassalamualaikum wr wb

    Puji Nurani ( mahasiswa Pasca Sarjana S2 – kelas E – 10 jurusan Administrasi Pendidikan UNPAK – NPM : 072112200 )

  57. 65 Bunda Elis October 25, 2012 at 4:41 am

    Assalamu’alaikum wr.wb….

    Saya sangat tertarik dengan tulisan bapak tentang “Pengaruh Motivasi Dalam Peningkatan Kinerja”. Ulasan bapak tentang motivasi sudah sedemikian lengkap, namun saya mohon bapak membahas juga indikasi tentang peningkatan kinerjanya sebagai dampak dari pengaruh motivasi yang dilakukan.
    Kemudian dari tulisan bapak saya mempunyai kesimpulan ketika seseorang melakukan banyak pekerjaan maka dia harus banyak mempunyai motivasi agar apa yang dia lakukan bisa tercapai sesuai dengan yang diharapkan.
    Apa dampak positif dan negatifnya terhadap psikologis orang tersebut ?

    Demikian, saya tunggu tulisan bapak berikutnya. ( to be countinued ya pak..)

    Terima kasih….


    Elis Sajaah
    Mahasiswa Administrasi Pendidikan
    Semester 1 Pasca Sarjana UNPAK
    NPM : 072112180

  58. 66 Ose Warlina October 31, 2012 at 1:15 pm

    Salam perkenalan, pak saya Ose Warlina mahasiswa Pasca Sarjana E 10, saya sangat tertarik dengan tulisan bapak tentang motivasi. Motivasi sangatlah penting dalam kehidupan manusia, manusia bisa bertahan hidup karena memiliki motivasi untuk hidupnya tinggi, begitu juga seorang karyawan dia bisa bekerja dengan prestasi yang baik karena adanya motivasi. Motivasi bisa datang dari luar manusia itu sendiri bisa juga datang dari dirinya sendiri.Saya sangat setuju jika setiap manusia hidup mempunyai motivasi yang tinggi yang datang dari dalam dirinya, karena motivasi yang tumbuh dari dalam sulit untuk lenyap dari diri seseoran.Mudah-mudahan komen dari saya bisa berguna untuk semua . Terima kasih bapak saya tunggu artikel yang lainnya.

  59. 67 ahmadulyani (Kelas G5 Ciangsana) November 12, 2012 at 3:49 am

    Assalamualaikum wr wb,
    Membaca tulisan bapak saya sepakat hal tersebut.
    Sekarang ini banyak sekali training motivasi yang diikuti oleh perusahaan buat para karyawannya untuk meningkatkan kinerja bahkan ada training ESQ yang disampaikan oleh Ari Ginajar yang memadukan nilai-nilai agama untuk memotivasi sesorang untuk bekerja tanpa pamrih.
    Dahulu saya selepas menyelesaikan kuliah saya bekerja menjadi seorang karyawan swasta, hasil pekerjaan saya sangat memuaskan pimpinan saya, saya tidak pernah berhalangan selalu masuk kerja dan saya berfikir suatu saat nanti apa yang saya kerjakan akan membuahkan peningkatan karir terhadap saya, tetapi setelah sekian lama apa yang saya harapkan tidak pernah terwujud bahkan karir saya tidak pernah naik. Akhirnya saya mendapat jawaban dari seseorang yang menyatakan bahwa pimpinan saya tidak mau mempromosikan saya karena takut akan kehilangan karyawan seperti saya yang mempunyai dedikasi dan motivasi yang tinggi dan disamping itu saya juga sebagai ujung tombak di departemen saya yang menghasilkan income yang tinggi.
    Kalau sudah seperti ini apa yang salah yah ?… karena dengan dedikasi dan motivasi yang tinggi membuat pimpinan takut akan kehilangan karyawannya untuk dipromosikan di depatement lain.

    Wassalamualaikum wr wb.
    Ahmad Ulyani
    Kelas G.5 Ciangsana Pasca Sarjana Unpak

  60. 68 Wiwin Widiastuti November 12, 2012 at 1:37 pm

    Assalamualaikum, wr wb
    salam kenal Pak Adie. ……
    Saya Wiwin Widiastuti, mahasiswa pasca sarjana Universitas Pakuan Bogor, kelas D7 jurusan Administrasi Pendidikan. Saya tertarik dengan tulisan mengenai PENGARUH MOTIVASI TERHADAP PENINGKATAN KINERJA.

    Memotivasi merupakan salah satu faktor kunci untuk bekerja dan mencapai kinerja yang tinggi. Kegiatan memotivasi berkaitan dengan sejauhmana komitmen seseorang terhadap pekerjaannya dalam rangka mencapai tujuan perusahaan dalam tulisan tersebut ada cara mengatasi racun motivasi,tehnik memotivasi kerja.

    dengan tulisan tersebut saya lebih paham tentang manfaat dari motivasi tersebut karena dengan motivasi yang tinggi akan mendapatkan hasil sesuai dengan tujuan perusahaan tersebut.
    jika kita hubungkan dengan pekerjaan saya sebagai guru bagaimana caranya dan tehnik untuk memberikan motivasi kepada peserta didik sehingga mempunyai motivasi yang tinggi pada dirinya ?

    ini saja komen saya, saya mohon masukanya dari pak adie untuk tulisan berikutnya.

    terimakasih wasalam….

  61. 69 Wiwin Widiastuti November 12, 2012 at 1:46 pm

    Assalamualikum wr. wb,

    Salam pak Adhie,, perkenalkan saya wiwin widiastuti, mahasiswa pasca sarjana UNPAK jurusan Adm, Pendidikan, kelas D7. saya sangat tertarik dengan tulisan Bapak mengenai Pengaruh Motivasi terhadap Peningkatan Kinerja.

    Motivasi merupakan salah satu faktor penting dalam mendorong seorang karyawan untuk bekerja. Motivasi adalah kesediaan individu untuk mengeluarkan upaya yang tinggi untuk mencapai tujuan organisasi (Stephen P. Robbins, 2001).

    Dalam tulisan Bapak ada teknik-teknik motivasi dan cara mengatasi racun motivasi. Semakin besar motivasi maka hasil yang didapatkan akan sesuai dengan tujuan dari perusahaan atau organisasi tersebut. saya sebagai guru, bagaimana cara untuk menumbuhkan motivasi yang tinggi terhadap peserta didik, sehingga mendapatkan hasil yang sesuai ?

    Hanya ini yang dapat saya komentari, dan mohon tanggapannya.


  62. 70 Reny Damayanti November 14, 2012 at 1:16 pm

    Ass pak Adhie…saya Reny Damayanti mahasiswa pasca Sarjana UNPAK kelas D7. saya tertarik dengan tulisan bapak tentang Karakteristik motivasi berprestasi. Menurut Mc Clelland bahwa kinerja seseorang dipengaruhi oleh virus mental yang ada pada dirinya yaitu virus sebagai pendorong kebutuhan yaitu kebutuhan berprestasi, kebutuhan berafilasi, dan kebutuhan berkuasa. Saya ingin menanyakan apakah virus mental yang ada pada diri seseorang dipengaruhi juga oleh Usianya? terimakasih pak Adhie..

  63. 71 donita seffina santi November 16, 2012 at 1:52 am

    Assalamualaikum Wr Wb

    Selamat pagi pak Adi, ada beberapa hal yang ingin saya komentari dari tulisan bapak yg pertama, tidak bisa dipungkiri motivasi untuk meningkatkan kinerja karyawan atau pegawai sangatlah penting untuk kesuksesan karier seorang pegawai atau karyawan, motivasi itu sendiri menurut saya bersifat sangat dinamis dan terus berkembang seiring berjalan nya waktu. Motivasi sangat rentan dipengruhi lingkungan sosial, kepribadian seseorang, dan virus-virus yang dapat menyebabkan menurun nya motivasi dalam berkerja, maka disini diperlukan mentenanance tersendiri bagi karyawan dan pemangku keputusan di dalam perusahaan, yang salah satu penyaluran nya adalah melalui komunikasi seperti apa yg dijelaskan pada Teknik Komunikasi Persuasif di atas.

    Selanjut nya, dari teory kebutuhan menurut Abraham Maslow, yang dijelaskan di atas pada dasarnya motivasi karyawan bekerja adalah untuk memenuhi kebutuhan kebutuhan, dari kebutuhan fisiologis, Kebutuhan rasa aman, Kebutuhan social, Kebutuhan harga diri,dan Kebutuhan aktualisasi diri. Dari teori pemenuhan akan kebutuhan berdasarkan hirarki yg dikemukankan Maslow ini, apakah hirarki motivasi ini selalu berlaku pada setiap jenis pekerjaan misal nya LSM, Pantiasuhan dan pekerjaan sosial lain nya? Jika dihubungkan dengan profesi guru secara profesional sebagai tenaga pendidik yang idealnya medapatkan kebutuhan aktualisasi yang optimal, apakah kebutuhan akan aktualisasi diri ini harus diabaikan setelah kebutuhan akan keamanan, kebutuhan sosial, terpenuhi?

    sekian komentar dari saya,..
    Wassalamu alaikum Wr. Wb.

    Donita Seffina Santi
    Mahasiswi semester 2 Pasca Sarjana Unpak
    jurusan Administrasi Pendidikan.

  64. 72 Jamrizal December 6, 2012 at 4:23 am

    Kenyataan dilapangan bahwa masih banyak sikap dari Pemimpin suatu Organisasi memberikan perintah langsung agar para staf (karyawan) bekerja dengan oftimal dan baik, dan ketika menemukan suatu kesenjangan, artinya tidak sesuai dengan keinginan pemimpin dan tujuan organisasi, maka saat itu atau beberapa selang sesudahnya pemimpin langsung mengambil tindakan perbaikan, ada yang ditegur, ada yang diberikan sangsi dan bahkan ada yang di PHK.

    Ini adalah sikap yang sangat sangat keliru, tapi anehnya malahan banyak pemimpin yang menganggap itu yang paling tepat dan baik, sebenarnya yang paling tepat dan baik itu adalah bagaiman seorang pemimpin tersebut mengambil sikap kembali ke hal hal yang paling mendasar. Tepatnya pahami dulu akan apa yang menjadi faktor dasar untuk menimbulkan semangat dan gairah kerja pada individu staf.

    Setelah saya membaca artikel Bapak, dan mencoba menarik benang merahnya, ternyata sesungguhnya yang perlu diperhatikan dan jika bisa dipenuhi oleh seorang pemimpin terhadap karyawannya adalah mengenal apa kebutuhan, apa kemampun, dan apa kepastian yang diberikan. Jika ini semua terpenuhi oleh seorang pemimpin, maka secara berlahan dan pasti bahwa semua staf memiliki sejumlah kesediaan yang besar untuk mengeluarkan upaya yang sangat tinggi dalam mencapai tujuan. Nah itu berarti Motivasi bekerja pada masing masing Individu tumbuh melalui proses. Sehingga hasilnaya akan terkesan dengan nyata bahwa Motivasi Staf betul betul dapat menghasilkan kinerja yang optimal dan baik.

    Maka dengan itu dapat disimpulkan bahwa motivasi benar berpengaruh dalan peningkatan kinerja organisasi ….

    Dari Jamrizal Mhs UNPAK Program Doktor NPM 073111049 asal Jambi.

  65. 73 Drs. Tatang Satari Royat (D7 Unpak) December 9, 2012 at 8:29 am

    Assalaamu’alaikum Wr. Wb.

    Setelah saya baca materi bapak tentang Motivasi, kalau tidak salah mencermati, saya mempunyai kesimpulan, bahwa motivasi untuk melakukan pekerjaan yang baik adalah hasil dari sebuah gaya kepemimpinan dan atmosfir lingkungan yang dapat meningkatkan kepercayaan diri, serta memberdayakan setiap individu di dalamnya.
    Demikian pak komentar saya,
    terima kasih.

    hormat saya,

    Drs. Tatang Satari Royat
    Kelas D7 UNPAK Bogor

  66. 74 Murad, S.Pd (D7 Unpak) December 9, 2012 at 8:33 am

    Assalamu`alaikum Wr. Wb.
    Bersyukurlah terhadap apa saja yang terjadi pada kita. Bersyukur akan senantiasa menuntun diri anda menyingkirkan sisi negative darianda.Mungkin ada orang yang mengatakan bahwa anda tidak realistis.Namun sebenarnya sikap anda jauh lebih realistis, yaitumembebaskan anda dari kecemasan dan kesalahan.. Bersyukur akan mendorong anda untuk bergerak maju penuh antusias. Yah, mendorong. Artinya mendapatkan Motivasi dari diri anda sendiri.Dan itu modal dasar terpenting dalam hidup.
    Dengan motivasi yang ada dihati, ia akan mendorong siempunya untuk bergerak, dan hidup itu pada dasarnya kumpulan gerakan. Ketika seseorang tidak bergerak maka ia menuju kematian. Dan mati adalah lawan dari gerak.
    Cobalah awali hidup anda dengan bersyukur lalu tersenyum. Maka dunia ini akan tersenyum kepada anda. Setiap kaki melangkah yang ada adalah senyuman. Setiap manusia yang anda temui akan tersenyum. Bungapun tersenyum menyambut anda, jalanpun tersenyum kepada anda. Kenapa terjadi hal demikian. Karena anda telah menanam benih yang bagus, yaitu motivasi dan berpikir positif. Lantas apa itu motivasi.
    Motivasi merupakan salah satu factor penting dalam mendorong seseorang untuk melakukan sesuatu. Hal ini tidak saja akan berpengaruh baik namun juga dapat meningkatkan kinerja seseorang. Sehinga seorang karyawan ataupun mereka bergerak di bidang bisnis lainnya, akan sangat membutuhkan motivasi, yaitu motivasi yang positive. Kebutuhan motivasi ini adalah kondisi internal yang harus selalu dihidupkan, sementara dorongan dari luar hanya merangsang atau hanya titik awal (Starting point).
    Pada dasarnya seseorang bekerja atau dalam melakukan sesuatu didorong untuk memenuhi kebutuhan sebagai berikut:
    • Kebutuhan fisiologis
    • Kebutuhan rasa aman
    • Kebutuhan social
    • Kebutuhan harga diri
    • Kebutuhan aktualisasi diri

    Bagaimana pisik membutuhkan asupan sesuatu untuk mempertahankan hidup, sehingga mereka dapat meneruskan keberlangsungan hidupnya. Tentu mereka juga butuh rasa aman baik di tempat kerja mereka ataupun secara keseharian, dimana mereka akan berinteraksi dengan masyrakat di sekitarny yang sama-sama juga membutuhkan rasa aman dan butuh teman. Sehingga mereka akan beruapaya menjadi orang yang dihargai oleh lingkungannya dan tentu mereka punya harapan untuk diakui oleh masyarakat sekitaranya dalam menampakkan keberadaannya.

    Murad, S. Pd. (072112055)

  67. 75 zaenal abidin December 11, 2012 at 3:19 pm

    Salah satu kunci terhadap karyawan adalah menempatkan dia sebagai pemimpin pada posisi jabatan dia sekecil apapun tanpa ada paksaan sehingga dia bisa bereksplorasi dengan dirinya dan jabatannya yang akan mengahsilkan karir terbaik walaupun itu posisi yang sangat bawah, karena sesuatu di mulai dari yang terkecil sampai dia menjadi besar tidak lupa akan posisi yang di bawah “kacang Tidak Lupa Kulitnya”

  68. 76 zaenal abidin December 11, 2012 at 3:23 pm

    Dan esensi motivasi itu sebenarnya ada pada dirinya yang dia akan dapatkan manakala dia menedkatkan diri Kepada Siapa yang menciptakan dan mematikannya pada malam hari sampai dia tak kuasa mentikan air mata walaupun sekelas menteri, itulah Motivasi yang Paling Abadi, Karena Tuhan tidak pernah marah apabila di mintai hambanya berulang kali sebaliknya manusia akan marah dan benci. La Tahzan Innaulooha ma’ana (Jangan Bersedih Sesungguhnya Alloh Bersama Kita) dalam menabur kebaikan di bumi ini.

  69. 77 zaenal abidin December 11, 2012 at 3:35 pm

    Dalam diri manusia, Dalamnya lautan dapat kau ukur denga ukuran yang kita buat, tapi dalamnya hati manusia tidak ada yang bisa mengukur tp kita dapat mengukur dari Rasulluloh SAW, yaitu Ciri orang munapik, Bila Engkau Berbicara maka berdusta, bila di percaya Khianat, dan Bila Berjanji ia mengingkari, penyakit ini sudah melekat sampai ke pejabat negara Sekelas Presiden.

  70. 78 zaenal abidin December 11, 2012 at 3:41 pm

    Andaikan manusia tau akan esensi dia hidup. untuk apa dilahirkan?, bagaimana dia hidup? dan akan kemana di setelah Hidup? maka manusia tidak akan bersikap seperti hewan yang dikodratkan tidak punya pikiran?

  71. 79 zaenal abidin December 11, 2012 at 3:44 pm

    Sampai detik ini Ilmu yang di buat manusia atau hukum tidak menyelesaikan masalah sosial maka saatnya kembali keapda sunah dan hadist yang telah di berikan lewat Rosulluloh SAW yang berlandaskan Wahyu Illahi,

  72. 80 zaenal abidin December 13, 2012 at 4:13 pm

    Janganlah Kau berkumpul dengan orang pesimis karena mereka mengambil sebagian mimpimu, Pohon semakin tinggi semakin kencang anginnya agar tetap kuat berdiri yaitu akar (Keyakinan), Man Jadda Wajada (Siapa yang bersunggug-sungguh pasti dia akan berhasil)

  73. 81 zaenal abidin December 13, 2012 at 4:16 pm

    Sekecil apapun pekerjaan senangilah dan pelajarilah siapa tau sekarang anda bekerja, esok atau lusa anda yang menjadi Owner pekerjaan yang sedang anda kerjakan sekarang ini, Berpikirlah I Can do This.

  74. 82 zaenal abidin December 13, 2012 at 4:19 pm

    Kesuksesaan yang di gapai dengan mudah akan hilang sekejap mata, berbeda kesuksesan di gapai dari bawah akan menjadi kenangan sepanjang masa bahkan bisa masuk buku Recor In The World, maka berkarirlah dengan tidak menggunakan jalan pintas

  75. 83 zaenal abidin December 13, 2012 at 4:25 pm

    Komponen Bisnis Bagaikan Organ Tubuh Manusia, sakit satu maka sakit semua organ tubuh, maka aturlah dari Bawahan sampai Pimpinan, satu aja tidak bekerja tukang sapu, maka kumuh lah tempat Bisnis tersebut

  76. 84 nunung nurhayati December 14, 2012 at 1:37 pm

    Assalamualaikum Wr.Wb.

    Membaca tulisan (artikel Bapak tentang “Pengaruh Motivasi Terhadap Peningkatan Kinerja”) sangat bagus dan dapat menambah wawasan, khususnya bagi saya. Memang benar motivasi merupakan salah satu faktor penting dalam mendorong seorang karyawan untuk bekerja. Tanpa adanya motivasi, seseorang tidak akan tercapai tujuanya dalam bekerja untuk mencapai ke arah yang lebih baik. Kalau motivasi tinggi pasti kinerja pun tinggi dan hasilnya pun bagus serta maksimal, sebaliknya Kalau motivasi rendah pasti kinerja pun rendah pula dan hasilnya pun tidak akan maksimal. Hal ini dapat dihubungkan di lingkungan tempat kerja saya yang berprofesi sebagai guru. Apabila memiliki motivasi yang tinggi untuk untuk mencapai keberhasilan, maka ia akan mempunyai tanggung jawab yang besar demi keberhasilan anak didiknya, akan menyusun rencana kerja (RPP) dengan baik,lebih memperhatikan anak didiknya, dan senang dengan tugas yang dilakukannya sehingga kinerjanya pun akan lebih meningkat. Akan tetapi, bila motivasi rendah maka ia tidak akan memiliki tanggung jawab dalam bekerja, asal masuk kelas dan tidak mempunyai tujuan yang jelas, bersikap masa bodoh terhadap anak didiknya, dan tidak akan senang dengan tugas yang dilakukannya. Jadi motivasi sangat berpengaruh terhadap kinerja seseorang.

    Demikian komentar saya, terima kasih Pak Adie ….
    Wassalamualaikum Wr.Wb.

    Nunung Nurhayati
    Kelas D7, Administrasi Pendidikan
    NPM : 072112042
    Program pascasarjana Unpak Bogor

  77. 85 muhammad sidik (NPM.073111056) January 1, 2013 at 12:49 am

    Assalamu’alaikum wr.wb.
    Gimana Kabarnya bapak? Mudah-mudahan selalu dalam lindungan-Nya. Amin.
    Saya M. Sidik/NPM. 073111056, Mahasiswa S3 Univ. Pakuan Bogor.
    Setelah membaca tulisan bapak tentang “Pengaruh Motivasi terhadap Peningkatan Kinerja” dapat saya pahami bahwa motiviasi merupakan suatu keadaan yang kompleks (a complex state) dan kesiapsediaan (preparoty set) dalam diri individu (organisme) untuk bergerak ke arah tujuan tertentu baik disadari maupun tidak disadari. Motivasi itu timbul dan tumbuh berkembang dengan cara : (1) datang dari dalam diri individu itu sendiri (intrinsic), dan (2) datang dari lingkungan (ekstrinsik). Peningkatan Kinerja dapat dilakukan dengan menstimulasi aspek-aspek yang membuat dirinya mau melakukan tindakan yang lebih mengarah pada prestasi kerja. Dengan demikian motivasi menjadi kekuatan utama untuk berprestasi. Dengan diraihnya prestasi secara otomatis kinerjanya akan meningkat.
    Demikian tanggapan saya.
    Wassalamu’alaikum wr.wb.

  78. 86 yuli hartati January 5, 2013 at 6:34 pm

    Assalamualaikum pak Adhie,saya Yuli Hartati mahasiswa PsAp Unv Pakuan Bogor kelas D-7.
    Setelah membaca artikel bapak yang berjudul
    Pengaruh Motivasi Terhadap Peningkatan Kinerja,saya ingin sedikit berkomentar sesuai dengan apa yang terjadi dengan diri saya sendiri.Ketika saya pertama kali diangkat jadi Capeg tepatnya lima bulan setelah wisudah,sangat memotivasi saya karna banyak sekali orang yang jauh lebih lama dari saya ngantri untuk menjadi PNS tapi belum terwujud,hal ini menimbulkan semangat bagi saya untuk bekerja lebih baik,karna ini adalah kesempatan emas yang tidak boleh saya siah-siahkan.Lewat pekerjaan ini bisa menjadi sumber untuk memenuhi kebutuhan saya secara ekonomi dan sosial,hal ini juga menumbuhkan motivasi saya untuk meningkat kinerja menjadi lebih baik karena kalau kinerja saya baik maka kemungkinan naik golongan atau jabatan juga menjadi lebih mudah.Berdasarkan hasil penelitian tentang motivasi berprestasi adalah menetapkan target atau standa rkeberhasilan,selalu berpikir positif terhadap sesuatu kejadian,memiliki tujuan yang jelas serta planing kerja yang menyeluruh.Dapat diambil kesimpulan dari berbagai pendapat ahli yang bapak kemukahkan diartikel bapak ,bahwa motivasi merupakan element yang tidak bisa dipisahkan setiap kali kita membahas tentang masalah kinerja.Dengan membaca i artikel bapak dapat menambah wawasan saya untuk membangun motivasi yang mulai menyusut serta trik untuk membangun kinerja menjadi lebih baik.Maaf bapak seyoganya komentar ini saya kirim tiga minggu yang lewat tapi waktu itu ada gangguan dan baru ingat lagi ketika baca jadwal kuliah bapak besok pagi,tapi tidak apalah tidak ada kata terlambat dalam belajar.


  79. 87 idasubhi January 20, 2013 at 2:51 am

    Assamu’alaikum pak Adie terima kasih atas kesempatan buat saya untuk mengomentari tulisan bapak tentang Pengaruh Motivasi Terhadap Peningkatan Kinerja
    Saya Berpendapat bahwa pemberian motivasi pada seseorang merupakan suatu mata rantai dimulai dari kebutuhan, menimbulkan keinginan, menyebabkan tensi, menimbulkan tindakan, menghasilkan keputusan.
    Terima kasih
    Wassamu’alaikum wr.wb
    Idarianty, Mahasiswi program S3 Kelas Jambi UNPAK Bogor

  80. 88 mardiyah January 21, 2013 at 1:52 pm

    Assalamualaikum Wr.Wb.

    Membaca tulisan bapak tentang “Pengaruh Motivasi dalam peningkatan Kinerja “, isinya sangat bagus dan sangat tertarik untuk membacanya. Motivasi memang sangat diperlukan dan sangat berpengaruh dalam dunia kerja. bila tidak ada motivasi kita tidak akan semangat dalam melakukan apapun, sehingga akan menjadi lebih baik dalam meningkatkan kinerja. jadi motivasi itu sangat penting untuk membangun diri kita dalam melakukan segala hal yang baik. itu saja Pak komentar saya, terima kasih.

    Wassalamualaikum Wr.Wb.

    Kelas D7, jurusan Administrasi Pendidikan
    Program pascasarjana Unpak Bogor

  81. 89 A. Khalil 073111039 January 26, 2013 at 9:15 am

    Saya nama Abdul Khalil Mhs S.3 Universitas Pakuan Bogor, nomor Induk Mahasiswa: 037111039 .Tanggapan terhadap tulisan Bapak di dunia maya yang berjudul PENGARUH MOTIVASI TERHADAP PENINGKATAN KENERJA.
    1.Pada prinsipnya tulisan tersebut adalah baik, karena saya merasa behwa tulisan ini dapat memberikan motivasi bagi saya dalam memperjuangkan suatu dalam dunia yang penuh de-ngan globalisasi; tantangan, harapan dan kejayaan.
    2.Suatu motivasi akan mampu memulihkan aktulisasi diri seseorang, karena motivasi dapat memberikan dorongan dalam mencapai tujuan organisasi dan peningkatan kinerja, namun jika seorang tidak termotivasi untuk peningkatan kinerja maka kan terjadi ketegangan dalam menghadapi pekerjaan yang sedang dihadapinya.
    3.Tulisan ini memacu semangat dan mendorong manusia untuk berpikir dan bekerja agar mencapai hasil yang beik serta memberikan manfaat yang banyak kepada masyarakat ,tulisan ini didukung oleh fakta fakta yang akurat dan meyakinkan.

  82. 90 Allan Setyoko January 28, 2013 at 3:08 pm

    Assalamualaikum wr wb,

    Setelah membaca artikel bapak, saya merasa termotivasi untuk melakukan sesuatu. Mulai kembali menata goal yang saya inginkan dengan membuat daftar yang berisikan hope, dan ini mungkin yang dinamakan visi kemudian membreakdownkannya menjadi misi.

    Motivasi merupakan salah satu faktor penting dalam mendorong seorang karyawan untuk bekerja. Bagi pemimipin motivasi merupakan dorongan untuk memberikan spirit baik kepada dirinya maupun karyawannya agar bekerja secara maksimal (peningkatan kinerja) dalam mencapai tujuan yang telah ditetapkan. Secara sederhana dapat diberikan pengertian bahwa motivasi merupakan kesediaan individu secara sukarela untuk mengeluarkan upaya yang tinggi untuk mencapai tujuan organisasi.

    Dari beberapa pendapat ahli motivasi, yang dapat kita petik adalah bagaimana seseorang itu dapat memberi dan menerima motivasi secara sukarela, sehingga dapat menggugahnya untuk bangkit dan berbuat yang terbaik untuk dirinya, orang lain maupun organisasi tempat ia bekerja.

    Demikian komentar saya,
    Wassalamualaikum Wr.Wb.

    Allan Setyoko
    Kelas S3 B1
    NPM : 073111040
    Program pascasarjana Unpak Bogor

  83. 91 A.Kadir January 30, 2013 at 11:52 am

    Assalamualaikum wr. wb.
    maaf pak, mau nanya, Gimana, kalau tujuan, strategi dan kebijakan organisai berubah, apakah dapat merubah motivasi tersebut?
    terimkasih. wassalam.
    A. Kadir,
    Mahasiswa S.3 prog. doktor
    kelas S3B1 UNPAK Bogor
    dari Jambi.

  84. 92 Jufriono January 31, 2013 at 8:58 am

    Assalamuallaikum Wr. Wb
    Setelah membaca tulisan bapa, saya sangat berpendapat dengan bapak bahwa motivasi itu sangat diperlukan dalam berbagai aspek kehidupan kita terutama didalam melakukan suatu pekerjaan kerena tanpa ada motivasi yang tinggi di dalam diri kita, maka akan apa yang kita kerjakan tidak akanmenghasilkanyang baik.
    Motivasi sangat di butuhkan tanpa kita sadari karena motivasi dapat kita peroleh dari pimpinan tempat kita bekerja, bias juga dari teman sejawat yang akan membuat kinerja kita yang menurun menjadi meningkat kerena adanya motivasi. Dengan motivasi yang kita miliki maka tujuan yang kita inginkan akan tercapai sesuai apa yang kita Inginkan.
    Demikian komentar saya semoga bermanfaat
    wassalamuallaikumWr. Wb
    Dari :
    Kelas : S3 B1
    Npm : 073111051

  85. 93 aam suminarsih February 4, 2013 at 7:14 am

    Àssalamualaikum w w,
    Selamat siang pak,saya aam suminarsih mshasiswi pasca sarjana semestet satu kls D 7. Saya tertarik suka dengan materi yg bapak berikan
    Tentang motivasi yang sesuai dengan status saya sebagai pendidik,karena motivasi sangat bermanpaat dan besar pengaruhnya terhadap peningkatan kwalitas pembelajaran untuk kemajuan anak didik kita. Sementara hanya ini komentar saya tentang motivasi.burung irian burung cendrawasih, cukup sekian dan terima kasih.

  86. 94 Idarianty Mahasiswi NPM: 073111048 S3 UNPAK Bogor Kelas 3 B1 Jambi February 6, 2013 at 3:21 pm

    Abraham Maslow mencoba untuk mensintesis penelitian tubuh besar yang berkaitan dengan motivasi manusia Sebelumnya. Menurut Maslow, umumnya terfokus secara terpisah pada faktor-faktor seperti biologi, prestasi, atau kekuatan untuk menjelaskan apa yang memberikan energi, mengarahkan, dan memelihara perilaku manusia.
    Maslow mengemukakan hirarki kebutuhan manusia didasarkan pada dua kelompok:1. kebutuhan defisiensi dan 2.kebutuhan pertumbuhan. Dalam kebutuhan kekurangan, masing-masing kebutuhan yang lebih rendah harus dipenuhi sebelum pindah ke tingkat berikutnya yang lebih tinggi. Setelah masing-masing kebutuhan telah terpenuhi, jika pada beberapa waktu mendatang kekurangan terdeteksi, individu akan bertindak untuk menghapus kekurangan.
    empat tingkat pertama adalah:
    1. fisiologis: rasa lapar, haus, kenyamanan,
    2.keselamatan / keamanan: keluar dari bahaya,
    3.harga diri dan cinta: afiliasi dengan orang lain, dapat diterima,
    4. Esteem: untuk mencapai, kompeten, mendapatkan persetujuan dan pengakuan.
    Dari kesimpulan di atas, seorang individu siap untuk bertindak atas kebutuhan pertumbuhan apabila kebutuhan defisiensi terpenuhi. Konsep awal Maslow termasuk hanya satu pertumbuhan membutuhkan aktualisasi diri.

  87. 95 ade komala February 8, 2013 at 2:40 pm

    Saya Ade Komala DS, mahasiswa D7 Unpak .
    Saya sangat tertarik dg materi yg bapak tulis. Seseorang dalam mencapai tujuan sudah pasti perjuangan banyak halangan dan rintangan. Agar seseorang tsb tetap dalan kondisi siap dan semangat sangatlah memutuhkan motivasi. Baik itu motivasi intrinsik dan ekdtrinsik. Begitu pula dg motivasi seseorang bisa m,erubah pola kinerja ke arah lebih baik, terprogram dan terorganisir sehingga proses maupun hasilnya lebih bsik.

  88. 96 sri wahyuningsih February 17, 2013 at 8:53 am

    selamat sore Pak Adi
    Setelah saya membaca artikel Bapak tentang “Pengaruh Motivasi Terhadap Kinerja”, saya sangat tertarik dengan yang bapak tulis. Motivasi merupakan keinginan, hasrat motor penggerak dalam diri manusia, motivasi berhubungan dengan psikologi manusia yang mencerminkan antara sikap, kebutuhan dan kepuasan yang terjadi pada diri manusia sedangkan daya dorong yang di luar diri seseorang ditimbulkan oleh pimpinan.
    Pentingnya motivasi karena motivasi adalah hal yang menyebabkan, menyalurkan dan mendukung perilaku manusia supaya mau bekerja sama sercara giat sehingga mencapai hasil yang optimal.

    Sri Wahyuningsih
    kelas D7, Administrasi Pendidikan

  89. 97 March 4, 2013 at 5:20 pm

    Assalamu’alaikum Wr. Wb

    Saya orang yang optimis bahwa, dalam melakukan suatu pekerjaan seseorang ingin selalu memperoleh hasil yang lebih baik. Untuk memperoleh hasil yang lebih baik, seseorang harus melakukan berbagai upaya yang berhubungan dengan pekerjaan yang di lakukan; mulai dari persiapan, pelaksanaan, sampai dengan pengevaluasian. Selain upaya-upaya tersebut, faktor lain yang juga sangat berpengaruh untuk memperoleh hasil pekerjaan yang lebih baik adalah motivasi yang kuat dari dalam diri individu itu sendiri. Sebagaimana pendapat Hamzah B. Uno dalam bukunya Teori motivasi dan Pengukuran, “motivasi adalah dorongan dasar yang menggerakkan seseorang bertingkah laku atau melakukan sesuatu sesuai dengan dorongan dalam dirinya”. Motivasi juga dapat dikatakan sebagai kekuatan, baik dari dalam maupun dari luar yang mendorong seseorang untuk mencapai tujuan tertentu yang telah ditetapkan sebelumnya. Dengan motivasi itulah seseorang akan berusaha sekuat tenaga dalam mencapai tujuan yang ingin dicapainya.

    Wassalamu’alaikum Wr. Wb

    syamsul huda
    Mhs. Pascasarjana S3 UNPAK Bogor
    Program Studi Manajemen Pendidikan
    Kls. S3 B1 Npm : 073111066

  90. 98 tony March 21, 2013 at 2:43 am

    assalamu’alaikum, pa haji, saya toni dari kelas E.10 semester 2, dari tulisan bapak saya bisa lebih memahami tentang hubungan motivasi dengan tingkat kinerja seseorang dalam melakukan suatu aktivitas baik sebagai individu maupun sebagai bagian dari suatu kelompok kerja. Satu hal yang sangat menarik bagi saya, bahwa ternyata tingkat motivasi yang tinggi dari seorang individu tidak selalu menghasilkan tingkat kinerja yang tinggi dan menghasilkan kinerja yang baik. Karena antara motivasi disatu sisi dengan kinerja disisi lainnya ada faktor lain yang berpengaruh terhadap hasil kinerja seorang indivdu.

  91. 99 usmanhakim12 May 17, 2013 at 1:14 pm

    Assalamu ‘alaikum wr.wb. Bapak….
    Membaca artikel Bapak yang berjudul “Pengaruh Motivasi Terhadap Peningkatan Kinerja” saya mendapatkan Ilmu Pengetahuan dan pencerahan, ternyata bahwa hidup ini tidak bisa sendiri kita sangat membutuhkan orang lain baik dari lingkungan keluarga, di tempat kerja di kantor, di sekolah, ataupun masyarakat luas dan itu akan memberikan motivasi dalam perjalanan hidup kita, dan dilihat dari kenyataan yang terjadi, bahwa motivasi sangat dibutuhkan guna memberi stimulus kepada para karyawan untuk meningkatkan kinerjanya dalam melaksanakan pekerjaan. Dorongan moril dari para atasan, gaya kepemimpinan, pengakuan atas prestasi, serta reward biasanya menjadikan karyawan lebih senang dan semangat. Karena jika dilihat dari teori yang dikemukakan oleh Herzberg tentang teori Hygine dan motivator bahwa gaya kepemimpinan dan gaji mempengaruhi kepuasan kerja karyawan, begitu juga dengan pengakuan dan penghargaan presteasi juga mempengaruhi kepuasan kerja karyawan. Karena pada dasarnya karyawan akan lebih merasa berharga dan jasanya dibutuhkan jika keberadaan mereka diakui dan prestasinya dihargai sehingga munculah motivasi dalam diri mereka. Tetapi sekuat apapun motivasi yang datang dari luar (ekstrinsik) tidak akan maksimal tanpa diimbangi dengan motivasi yang timbul dari diri sendiri (intrinsik), sebagaimana firman Allah swt. yang terdapat di dalam Qur’an yang artinya ….” Sesungguhnya Allah tidak akan mengubah keaadaan suatu kaum, sebelum mereka mengubah keadaan diri mereka sendiri.” (QS. Ar-Ra’d, 13:11).

    Terima kasih atas artikelnya Pak.
    Usman Hakim
    Kelas S-3 E 2
    NIM. 07113020
    Program Pasca Sarjana UNPAK BOGOR

  92. 100 hanantarya10 May 20, 2013 at 11:47 am

    terimakasih pak, artikel Bapak yang berjudul “Pengaruh Motivasi Terhadap Peningkatan Kinerja”, sangat membantu dalam menambah pengetahuan dan wawasan baru. memang motivasi sangat dibutuhkan oleh Pegawai atau karyawan dalam membantu meningkatkan kinerjanya, saya setuju atas apa yang Bapak tulis. Pimpinan atau manajer seharusnya memiliki peranan penting dalam membuat karyawan merasa dihargai pekerjaannya sehingga karyawan pun merasa termotivasi untuk mengerjakan pekerjaan yang ditugaskan oleh pimpinan atau atasan sehingga tujuan yang direncanakan bisa tercapai tepat waktu dan tepat sasaran.

    Hanan Tarya
    NPM. 073113005
    Kelas S.3 E-2
    Pascasarjana UNPAK Bogor

  93. 101 jadwal training ahli k3 July 3, 2013 at 2:47 am

    Hello! I simply want to give you a huge thumbs up for the
    excellent info you have right here on this post. I am coming back to your site for more soon.

  94. 102 Abdul Rahman H September 28, 2013 at 3:16 pm

    Assalamu’alaikum.Wr.Wb. Salam kenal Pak, saya mahasiswa pascasarjana Pakuan semester 1 tahun 2013 Prodi AP. saya senang bisa banyak membaca tulisan – tulisan yang bapak simpan di blog karena banyak pengetahuan tambahan yang saya dapatkan. untuk soal motivasi, saya setuju bahwa setiap orang harus menciptakan sebuah motivasi baik dari dirinya sendiri maupun berasal dari luar dirinya sendiri. karena dengan adanya motivasi maka seseorang akan berbuat lebih baik sehingga akan meninggalkan kesan positif dibanding kesan negatif. kita bisa membuktikan bahwa kita adalah orang baik, orang hebat dan bisa diandalkan. yang paling penting, niatkan semua aktivitas kita untuk ibadah karena Allah maka akan mempunyai motivasi yang tinggi, selalu bersyukur artinya manfaatkan nikmat kerja dengan sebaik – baiknya sebagai bentuk rasa syukur dan harus mempunyai mental juara karena akan menginginkan yang terbaik. terimakasih pak.

    Abdul Rahman H
    Prodi AP
    kelas A.1.1
    NPM : 072113002
    Pascasarjana Unpak 2013

  95. 103 mufi September 30, 2013 at 2:57 am

    Terimakasih sudah memperkenalkan blogs ini pak, setelah membaca materi ini saya menyerap banyak pelajaran yang menjadi motivator saya agar lebih giat lagi dalam menempuh pasca unpak ini

  96. 104 JANWAR KAKA October 2, 2013 at 2:41 am

    assalamualaikum wr. wb. tulisan yang sangat baik untuk dibaca dan dapat dipahami sebagai masukan untuk kita memotivasi diri dalam hal apapun. intinya dari kesimpulan postingan di atas adalah motifasi dalam bidang apapun didadapat karena ada keinginan dalam diri, suport dari orang-orang yang berada di sekeliling kita dan mampu mengalahkan apa yang menjadikan hambatan dalam diri kita untuk memotivasi kita.
    “Hidup bagaikan menaiki sepeda. Agar tetap seimbang anda harus tetap bergerak” Albert einstein.

    Mahasiswa Semester 1 Pasca Sarjana Universitas Pakuan

  97. 105 nurochmah nada October 3, 2013 at 5:52 am

    Assalamu’alaikum wr. wb

    Selamat siang, Pak Adie, saya Nurocmah mahasiswi semester 1 pascasarjana UNPAK ,A.1.1.

    Coment saya tentang “pengaruh motivasi terhadap peningkatan kinerja” tulisan tersebut menambah wawasan ilmu tentang motivasi,karena motivasi dapat meningkatkan kinerja seseorang.

    Sebagai manusia kita harus pandai-pandai menggali motivasi instrinsik dan motivasi ekstrinsik.Motivasi instrisik berupa bakat,minat.Motivasi ekstrinsik berupa keadaan lingkungan,keadaan sosial budaya,keadaan ekonomi , kedua motivasi itu berpengaruh juga terhadap kinerja seseorang.

    Kepempinan dan gaya kepemimpinan atasan sangat berpengaruh terhadap kinerja seseorang.Kepeminan atasan yang bijaksana,mengarahkan,mengayomi bawahan , pengawasan dari atasan sangat berpengaruh pada prestasi kerja.

    yang perlu dipelajari adalah tindakan dan cara mengatasi racun dan penurunan motivasi dengan pendekatan kuratif dan antisipatif.

    Dalam tulisan yang bapak tulis bagi saya yang dapat diterapkan dalam kehidupan sehari-hari adalah berpikir positif thinking dan bekerja berpatokan pada pencapaian tujuan yang telah kita kehendaki dan cita-citakan.

    Wasalamu’alaikum wr. wb

    Nurocmah, mahasiswi semester 1,pascasarjana UNPAK
    kelas A.1.1
    NPM: 072113025 Assalamu’alaikum wr. wb

  98. 106 Gurda Krissetyo R October 3, 2013 at 6:41 pm

    terima kasih pak telah memperkenalkan saya pada blog ini dan mohon izin pula untuk comment. terkadang merasa sangat malu dan minder ketika melihat sahabat, rekan sejawat lebih baik dibandingkan diri kita, dan merasa di anak tirikan oleh atasan. perlahan, semua yang dirasakan menjadi senjata untuk bangkit, saya sangat setuju dengan apa yang telah ditulisakan oleh bapak bahwa motivasi baik secara intrinsik maupun ekstrinsik akan menjadi modal kekuatan untuk menjadi lebih baik. jika faktor intrinsik itu besar dan berdampingan dengan ekstrinsik insya Allah akan membuat kita tangguh dalam mengarungi kehidupan salah satunya di dunia kerja. Allah tidak akan merubah suatu kaum jika kaum tersebut tidak mau berusaha untuk berubah……Jadikan ibadah sebagai motivasi terbesar dalam menjalani aktivitas.
    sekian Comment dari saya, semoga bermanfaat, dan mohon maaf jika ada tulisan ini yang tidak berkenan

    Gurda Krissetyo R (072113013)
    AP 1.1
    Pasca Sarjana Unpak

  99. 107 Andi maulana October 4, 2013 at 11:23 pm

    Motivasi memang memegang peranan penting ternyata, dengan membaca artikel tadi hal ini menjadi semakin jelas. Dapat dikatakan tanpa adanya motivasi tidak akan ada aktivitas, bukan begitu pak? Artikel ini sangat menarik karena memberi informasi mendalam mengenai motivasi, such enlighting article to read.

    Andi maulana
    A.P 2013

  100. 108 Nina Suryadie October 6, 2013 at 12:27 pm

    Assalamu’allaikum Warrahmatullahi Ta’alla Wabarakatuh …
    Terima kasih atas informasi Blog yang Bapak punya ini, saya membaca tulisan dan postingan Bapak disini, Subhanallah .. semuanya memberikan motivasi tersendiri untuk saya supaya lebih baik lagi dalam segala hal. Selain dari niat tentunya yang tidak kalah penting adalah MOTIVASI, baik motivasi intrinsik maupun ekstrinsik dalam pencapaian cita2 dan harapan yang kita inginkan. Pada dasarnya saya suka menulis juga, tapi lebih tulisan saya bukan karya ilmiah atau tulisan yang berhubungan dengan ilmu pengetahuan seperti ini, Tulisan saya lebih banyak mengarah kepada sastra berupa puisi dan novel, mudah2an setelah membaca tulisan bapak tentang MOTIVASI saya bisa menulis ilmiah seperti Bapak. Saya tunggu postingan berikutnya Pak. JazakAllahu Khoiron Khatsira Pak dosen.
    ( Imas Mastriah, Mahasiswa Pasca sarjana Jurusan AP kelas A.I.1 )

  101. 109 Imas Mastriah October 6, 2013 at 2:16 pm

    Comment saya tentang MOTIVASI :
    Motivasi pada umumnya mempertinggi prestasi dan memperbaiki sikap terhadap tugas dengan kata lain, motivasi dapat membangkitkan rasa puas dan menaikkan prestasi sehingga melebih prestasi normal.
    Hasil baik dalam pekerjaan yang disertai oleh pujian merupakan dorongan bagi seseorang untuk bekerja dengan giat. Bila hasil pekerjaan tidak diindahkan orang lain, mungkin kegiatan akan berkurang. Pujian harus selalu berhubungan erat dengan prestasi yang baik. Anak-anak harus diberi kesempatan untuk melakukan sesuatu dengan hasil yang baik, sehingga padanya timbul suatu “sense of succes” atau perasaan berhasil.
    Motivasi berprestasi merupakan harapan untuk memperoleh kepuasan dalam penguasaan perilaku yang menentang dan sulit (Mr. Clelland, 1955).

  102. 110 wiwihilwiah November 5, 2013 at 7:13 am

    wiwihilwiah pascasarjana Ciangsana G6

    Ass wr wb

    setelah saya membaca artikel bapak saya teringat pepatah Cina yang mengatakan bahwa: Berilah seekor ikan pada seseorang dan anda telah memberinya lauk pada hari itu.Ajarilah mereka cara untuk mendapatkan ikan ,dan anda telah memberinya lauk ukntuk seumur hidupnya .Motivasi di ibaratkan ikan yang bisa menjadi lauk dalam hidup sesorang karna motivasi adalah jalan menuju keberhasilan meraih prestasi dalam mencapai tujuan hidup.

    wassalamualaikum wr wb

  103. 111 nely rizanaty November 5, 2013 at 8:29 am

    Assalamu’alaikum Wr.Wb….
    saya nely rizanaty mahasiswi pasca sarjana Unpak semester satu kelas Ciangsana G6.
    Menarik membaca tulisan Bapak tentang “Pengaruh Motivasi Terhadap Peningkatan Kinerja”, karena memang motivasi sangat diperlukan khususnya dalam bidang pendidikan. Teori kebutuhan Abraham Maslow menjawab berbagai persoalan yang dihadapi seorang pendidik dalam menjangkau tujuan dunia pendidikan. Sebab peningkatan kinerja pendidik tidak berbanding lurus dengan kompetensi pendidik itu sendiri, akan tetapi juga faktor lingkungan dan motivasi diri.
    Semoga bermanfaat.
    Wassalamu’alaikum Wr.Wb..

  104. 112 Sanudin November 6, 2013 at 11:49 am

    “Pengaruh Motivasi Terhadap Kinerja ”
    Motivasi memang memegang peranan penting bagi kehidupan sehari hari karena tanpa adanya motivasi akan menimbulkan kejanuhan kerja, dengan adanya motivasi maka lambat laun akan adanya perubahan kinerja yang positif.Seorang pemimpin yang bijak harus memberikan motivasi pada karyawannya agar karyawan tersebut terpacu untuk melakukan kinerja sehingga akan lebih baik hasilnya.

    Nama : Sanudin
    NPM : 072113148
    Kelas : Ciangsana/G 6

  105. 113 Dini Nurdiniah November 12, 2013 at 1:20 am

    saya ingin memberikan komentar dari tulisan bapak,tapi sebelumnya saya ingin mengucapkan terimakasih karena setelah membaca tulisan bapak,pengetahuan saya bertambah dan secara tidak langsung juga saya termotivasi dan ingin memotivasi orang-orang yang ada di sekitar saya,terutama adalah murid-murid saya. Karena menurut saya,guru bukan hanya bertugas untuk mentransfer ilmu yang dimilikinya,akan tetapi juga bisa menjadi motivator dan inspirator bagi murid-muridnya. Menurut saya, motivasi bisa muncul berdasarkan faktor internal dan eksternal. Faktor internal yaitu motivasi yang muncul dari dalam diri individu itu sendiri, sedangka faktor eksternal yaitu mtivasi yang muncul bukan dari diri individu melainkan dari luar,seperti motivasi yang muncul dari teman, keluarga,guru,atau bisa dikatakan dari lingkungan tempat tinggal. Apabila dari kedua faktor ini bisa didapatkan, maa akan ada pengaruh yang sangaat baik bagi diri kia. Termotivasi dengan orang lain itu sangatlah bagus, tetapi apabila bisa menjadi motivator dan memberikan motivasi yang positif terhadap orang lain itu jauh lebih baik, karena ketika kita memotivasi orang lain, itu samadengan kita memotivasi diri kita sendiri. Semoga kita bisa menjadi motivator bagi diri kita dan orang lain…aamiin..semoga bermanfaat.

    Dini Nurdiniah
    Kelas A.1.2

  106. 114 Sukirah November 12, 2013 at 12:33 pm

    salam kenal pak Adie, saya Ira, mahasiswa semester pertama kelas G6 Administrasi Pendidikan di Universitas Pakuan Bogor. (Ciangsana)

    komentar saya terhadap tulisan bapak yang berjudul “Pengaruh Motivasi Terhadap Peningkatan Kinerja” adalah, bahwasannya setiap orang pasti mengenal apa itu motivasi, namun tidak semua orang memiliki motivasi yang sama.

    Ketika pimpinan maupun rekan sejawat memberikan motivasi, bawahan/rekannya tersebut belum tentu dapat termotivasi, karena yang akan mendorongnya untuk bergerak adalah motivasi yang berasal dari dalam dirinya sendiri. seberapa hebatnya pun motivator memberikan rangsangan, bila individu tidak menginginkannya, maka motivasi itu tidak dapat timbul. saya berpendapat bahwa motivasi itu tergantung dari kesadaran dari setiap individu, serta dari harapan dan keyakinan yang besar dalam mencapai sesuatu.

    demikian saja pak komentar yang dapat saya berikan.

  107. 115 Parlina Susi Siswanti (kelas Ciangsana) November 13, 2013 at 7:23 am

    Assalamu’alaikum wr. wb.
    salam kenal pak Adie, saya mahasiswa semester pertama kelas G6 Administrasi Pendidikan di Universitas Pakuan Bogor. Membaca tulisan bapak, saya jadi teringat akan skripsi saya yang juga membahas mengenai MOTIVASI, namun saya lebih terfokus pada hubungan guru dan siswa karena saya memang mengambil jurusan Pendidikan Guru Sekolah Dasar.

    Tulisan bapak membuka wawasan saya, bahwa motivasi ternyata sangat luas jangkauannya, motivasi harus dimiliki oleh seluruh manusia, karena motivasi memiliki daya penggerak,, motivasi bisa berasal dari dalam (internal) maupun dari luar (eksternal), dan cara memotivasi setiap orangpun berbeda-beda. nah, dari cara memotivasi itu (stimulus) ada banyak pula tanggapan -terhadap motivasi- (respon), ada yang berhasil (langsung termotivasi) ada pula yang justru menganggapinya dengan negatif dan membuat down.

    Menurut saya, motivasi seseorang itu tergantung pada diri masing-masing, karena tanggapan terhadap motivasi yang didapatkan dari orang lain tidak akan sama (belum tentu dapat menggerakkan bila tanpa keinginan dari diri sendiri), dan hanya orang tersebut yang mampu menilai tingkat motivasi yang ia miliki..

    pak, saya mau bertanya, bagaimana pendapat Anda, ketika ada kenaikan gaji,, sehingga kinerja ditingkatkan,, berarti yang mendorong kinerjanya hanyalah uang, tanpa ada keinginan dari hati, apakah itu motivasi yang murni??
    terima kasih pak.
    Wassalamu’alaikum wr. wb.

    • 116 Performance Tech Adie November 14, 2013 at 7:05 am

      Dear all
      Banyak yang bertanya tentang apakah gaji memiliki korelasi dengan kinerja. Menurut teori 2 faktor dari Herzberg (da Mazlow) bahwa gaji termasuk faktor dasar atau higienis. Kenaikan gaji hanya menghilangkang ketidakpuasan buka memberi kepuasan. Jadi jikakita ingin kinerja meningkatkan maka diperlukan faktor motivator, misalnya tantangan, tanggungjawab, penilaian kinerja dan rewards.

  108. 117 ilmiyati November 14, 2013 at 1:51 pm

    Assalamu’alaikum Wr. Wb.

    Selamat malam Bapak. Saya Ilmiyati, mahasiswi susulan semester pertama kelas G-6 (kelas Ciangsana) Administrasi Pendidikan Program Pasca Sarjana Universitas Pakuan.

    Membaca makalah Bapak sangat menarik sekali. Memotivasi ternyata menjadi hal yang sangat penting atau menjadi salah satu faktor kunci untuk bekerja dan mencapai kinerja yang tinggi. Kegiatan memotivasi sendiri berkaitan dengan sejauh mana komitmen seseorang terhadap pekerjaannya dalam rangka mencapai suatu tujuan.

    Motivasi itu sendiri dapat diartikan sebagai upaya yang dapat memberikan dorongan kepada seseorang untuk mengambil suatu tindakan yang dikehendaki. Ada tiga elemen penting dalam motivasi yaitu : upaya, tujuan organisasi dan kebutuhan.

    Pada umumnya kinerja yang tinggi dihubungkan dengan motivasi yang tinggi dan sebaliknya motivasi rendah dihubungkan dengan kinerja yang rendah.

    Pak… Ada sesuatu yang ingin saya tanyakan. Bagaimana kita bisa memotivasi orang-orang di sekitar kita, bila saat itu diri kita sendiri sedang dalam motivasi yang rendah? Padahal pekerjaan memotivasi itu sendiri tetap harus kita lakukan demi tujuan suatu organisasi atau perusahaan?

    Terima kasih, Pak. Wassalam.

  109. 118 Nita Karmila November 15, 2013 at 3:59 am

    Pa, nita karmila kelas a.1.2 Pps.unpak prodi AP NPM 072113056..membaca tulisan bp memberikan wawasan yg luar biasa bg sy,.,paparan yg bp utarakan tdk jauh brbda dg kesan sy swaktu bp ngajar d kelas,,padat,singkat, jelas dan mengerti bgt,..trmksh pa,,smoga semakin hr smkin bnyak ilmu yg bp share lwt web ini,,amin

  110. 119 lusi susiandari November 16, 2013 at 4:02 am

    assalamualaikum wr wb. sy tertarik dengan paparan bapak mengenai motivasi kerja. saya pahami bahwa motivasi kerja dapat dipengaruhi oleh faktor internal yang berasal dari dalam individu pekerja dan faktor eksternal yang berasal dari luar. adanya reward and punnishment dan fungsi manajemen yg berjalan baik pada gilirannya menciptakan suasana kerja yg baik, sehingga menaikkan motivasi kerja para pekerjanya. (lusi susiandari, kelas a12, npm 072113052, unpak)

  111. 120 imelda November 17, 2013 at 3:51 pm

    Trimakasih artikel bapak sangat bermanfaat sehingga menambah wawasan saya,
    Motivasi merupakan faktor penting terhadap peningkatan kinerja, karna dengan motivasi setiap individu mau bekerja keras dan antusias untuk mencapai produktivitas kerja yang tinggi, motivasi harus diberikan pimpinan terhadap bawahannya, kalau tidak ada motivasi akan banyak potensi pegawai yang tidak bisa berkembang dan tidak akan memperoleh hasil pekerjaan yang maksimal.

  112. 121 yulistiana dewi November 20, 2013 at 12:00 pm

    assalamualaikum wr.wb.

    saya yulistiana dewi, setelah saya membaca blog bapak tentang “pengaruh motivasi terhadap peningkatan kinerja”, memang pada dasarnya setiap orang itu harus memilki motivasi dalam hidupnya, motivasi itu ada yang berasal dari dalam diri kita (internal) dan motivasi dari luar (eksternal), dua-duanya sangat penting, apalagi saya sebagai seorang pendidik merasakan bahwa memang motivasi itu sangat dibutuhkan untuk meningkatkan kinerja kita. bukan hanya itu saja apalagi kalo misalnya didukung dengan seorang pimpinan yang baik dan yang memilki motivasi yang tinggi dalam pekerjaan, dan menurut saya itu akan membuat kita sebagai bawahan terinspirasi sehingga kita akan lebih termotivasi dan memberikan kinerja yang terbaik untuk kedepannya. selain itu anak didik saya juga memberikan motivasi pada diri saya untuk memberikan pembelajaran yang lebih baik lagi…..terima kasih

    Yulistiana Dewi (072113067) A12

  113. 122 emiliana November 20, 2013 at 1:30 pm

    Terima kasih Pak Adie artikelnya.
    Motivasi sangat penting untuk meningkatkan kinerja karyawan.
    Tanpa motivasi , seseorang tidak mempunyai greget ( kehendak kuat ) untuk mencapai hasil terbaik.
    Ada motivasi instrinksik , ada motivasi ekstrinsik.
    Menurut saya, dua-duanya bisa mempengaruhi dalam peningkatan hasil kinerja seseorang.
    Seberapa besar pengaruhnya? Dalam hal-hal tertentu tergantung pada reward dan hasil yang diperkirakan akan diperoleh yang mereka sudah prediksikan..
    Yang membedakan adalah sikap seseorang tersebut terhadap kerjanya.
    Orang yang mempunyai motivasi ekstrinsik, pada umumnya mau bekerja baik kalau ada reward yang sesuai .
    Sedangkan orang yang memiliki motivasi intrinsik, orang tersebut mempunyai kesadaran dan tanggung jawab terhadap tugasnya.

    Emiliana Surajinah , NPM 072113043

  114. 123 Irma Nani Nuryanti November 21, 2013 at 5:37 am

    Assalaamu’alaikum Wr.Wb
    Terima kasih saya sudah di beri kesempatan untuk belajar mengomentari pendapat Bapa yang begitu tinggi ilmunya.Menurut saya motivasi dibutuhkan dalam segala hal terutama dalam pendidikan,fungsinya untuk memicu anak semangat dalam belajar sehingga anak bisa berkreasi dan berprestasi,motifasi bisa berbentuk moril dan materil,contohnya ketika anak rengking 1 kita beri hadiahnnah itu motivasi secara materil,sementara motivasi secara moril anak diberi contoh-contoh keberhasilan orang-orang yang sudah sukses sebelumnya.oleh karna itu dengan motivasi mendorong orang untuk berkreasi dan berprestasi.
    Demikian pendapat saya,kekurangannnya semata-mata kebodohan saya,kelebihannya hanya ada pada Bapa sebagai Dosen saya.

    Irma Nani Nuryanti
    Mahasiswa Pasca UNPAK sem 1 kls Ciangsana(G.6)

  115. 124 Intan Nur Raudoh November 22, 2013 at 2:49 am

    Assalamualaikum wr. wb
    artikel Bapak yang berjudul “Pengaruh Motivasi dalam Meningkatkan Kerja” ini sangat menarik dan saya mendapat banyak wawasan baru. saya menyimpulkan bahwa motivasi terbentuk karena faktor internal dan faktor eksternal. motivasi ternyata bisa berdampak buruk terhadap kinerja pekerjaan jika kita tidak bisa mengendalikannya dengan baik, maka dari itu kita harus bisa menjaga motivasi yang baik agar berdampak baik pula bagi pekerjaan kita. demikian komentar dari saya semoga bermanfaat bagi kita semua.
    wassalamualaikum wr.wb
    Intan Nur raudoh NPM: 072113047 kelas A.1.2
    Mahasiswa Administrasi Pendidikan Universitas Pakuan

  116. 125 Asep Darmawan November 22, 2013 at 3:12 am

    Assalamualaikum Wr. Wb.
    Bicara mengenai motivasi sangat penting dalam kehidupan manusia, karena manusia dengan motivasi dapat mewujudkan apa yang menjadi keinginannya.
    Membaca makalah Bapak sangat menarik sekali. Memotivasi faktor kunci untuk bekerja dan mencapai kinerja yang tinggi. Motivasi merupakan upaya yang dapat memberikan dorongan kepada seseorang untuk mengambil suatu tindakan yang dikehendaki.
    Dalam dunia kerja ada tiga elemen penting dalam motivasi yaitu : upaya, tujuan organisasi dan kebutuhan. Ketiga elemen tersebut saling menunjang untuk mencapai keinginan atau tujuan yang dikehendaki oleh siapapun
    Dan juga motivasi bisa muncul berdasarkan faktor internal dan eksternal. Faktor internal yaitu motivasi yang muncul dari dalam diri individu itu sendiri, sedangka faktor eksternal yaitu mtivasi yang muncul bukan dari diri individu melainkan dari luar,seperti motivasi yang muncul dari teman, keluarga,guru,atau bisa dikatakan dari lingkungan tempat tinggal. Apabila dari kedua faktor ini bisa didapatkan, maa akan ada pengaruh yang sangaat baik bagi diri kia. Termotivasi dengan orang lain itu sangatlah bagus, tetapi apabila bisa menjadi motivator dan memberikan motivasi yang positif terhadap orang lain itu jauh lebih baik, karena ketika kita memotivasi orang lain, itu samadengan kita memotivasi diri kita sendiri.
    Terima Kasih
    Asep Darmawan
    NPM: 072113172
    Program Pasca Sarjana UNPAK
    Kelas G-6

  117. 126 irwan kurniawan November 22, 2013 at 6:43 am

    Assalaamu’alaikum Wr.Wb
    Terima kasih pak saya sudah di beri kesempatan. Menurut saya motivasi dibutuhkan dalam segala hal termasuk dalam pendidikan,didalam ajaran agama islam ketika kita akan melakukan kegiatan/kerja harus diawali dengan niat dan ikhlas, ketika dua hal tersebut sudah kita lakukan maka apapun yang kita lakukan pasti akan dilakukan dengan sungguh-sungguh. Artinya niat dan ikhlas merupakan motivasi awal yang mendorong kita selalu melakukan yang terbaik di setiap pekerjaan/aktivitas. Dalam dunia pendidikan motivasi dari guru dan siswa merupakan salah satu faktor yang menentukan ketuntasan belajar siswa. Pada setiap awal pembelajaran setiap guru pastinya akan memberikan motivasi dan stimulan positif terkait dengan materi yang diajarkan. Demikian pendapat saya, terimakasih.

    Irwan kurniawan
    NPM : 072113142
    Pasca UNPAK kelas G6 (ciangsana)

  118. 127 YEYEN SALSIAH November 22, 2013 at 12:19 pm

    Bapak Adie.E.Yusuf. yang terhormat,
    Setelah saya membaca artikel Bapak tentang Pengaruh Motivasi dalam peningkatan kinerja, saya berasumsi bahwa motivasi bener-benar sangat diperlukan dalam peningkatan kinerja.
    Jika dianalogikan tubuh manusia, motivasi adalah ruhnya seorang pekerja. Baik buruknya kinerja seseorang sangat dipengaruhi oleh motivasi yang ada dalam dirinya. Motivasi adalah kesediaan individu untuk mengeluarkan upaya yang tinggi untuk mencapai tujuan organisasi.

    NPM : 072113158

  119. 128 Endang November 22, 2013 at 5:17 pm

    Assalamu’alaikum Wr. Wb.
    bekerja dan belajar menjadi dorongan saya dalam memotivasi diri untuk melaju ke arah lebih baik, lebih-lebih faktor usia menurut sebagian masyarakat di lingkungan tempat saya tinggal menjadi alasan mereka untuk berhenti belajar dan berkarya, sehingga dalam estafet keberlangsungan kader-kader unggulan menjadi nuansa ketergantungan terhadap sisa-sisa jerih payah orangtua di masa lalu. dalam hal ini saya sadar, bahwa diri saya tidak harus terbelenggu dengan “harta orangtua adalah harta anak” akan tetapi yang harus ditanamkan adalah motivasi kerja orangtua di masa yang lalu merupakan peluang emas untuk memotivasi bekerja kita tanpa menyampingkan norma-norma budaya. saya tetap semangat dan terus berkarya setelah saya membaca tulisan pak adie pengaruh motivasi terhadap peningkatan kinerja.

    dari: Endang Mahasiswa S2 Pasca sarjana kelas Ciangsana

  120. 129 Iin Masnah November 24, 2013 at 6:54 am

    Mungkin ini tambahan aja dengan membaca blognya pa adie berkaitan dengan motivasi kerja ” kalau kerja diperusahaan besar ada peraturan peraturan tentang tenaga kerja,atau seperti yg tertera dalam teori teori diatas,tetapi kalau perusahaan kecil biasanya pengusaha itu selalu lupa upah ata gaji mungkin sering terlambat bahkan mengungkapkan kata kata yg kurang pantas di depan umum atau forum yg harusnya di berikan motivasi yg bagus jd imbasnya kinrja turun dan menyebabkan out seorang karyawan terimakasih .

  121. 130 Tari Sutirah A1.2 Pasca Unpak NPM: 07211-3064 November 24, 2013 at 3:07 pm

    Assalamualaikum Wr. Wb.
    Terima kasih Pak. Tulisan Bapak sedikit banyak telah memberikan wawasan yang lebih luas bagi saya tentang motivasi kerja. Menurut saya faktor eksternal menjadi alternatif untuk meningkatkan faktor internal. Kinerja, motivasi, kompetensi, dan kesempatan merupakan hubungan yang bersifat linear.
    Tentang teori motivasi, menurut saya teori Frederick Herzberg lebih rinci dan lebih tepat sebagai rujukan dan pijakan bagi management termasuk management tingkat satuan pendidikan, daripada teori Abraham Maslow.
    Teknik memotivasi kerja menurut saya lebih efektif digunakan secara combinasi antara teknik pemenuhan kebutuhan dan teknik komunikasi persuasif karena keduanya saling melengkapi.
    Pada sub bahasan tentang cara mengatasi penurunan motivasi saya setuju, tapi mungkin perlu dilengkapi dari aspek institusinya termasuk pimpinan. Misalnya pemberian kesempatan untuk mengembangkan diri, pengakuan, peningkatan reward dll.)
    Demikian menurut pemahaman saya.
    Saya berharap Bapak dapat meluruskan pemahaman saya bila kurang tepat, dan dapat memberikan pembahasan lebih jauh dalam kesempatan tatap muka perkuliahan. Amin.
    Wassalamualakum Wr. Wb.

    Tari Sutirah
    A.1.2 Pasca Unpak
    NPM: 02211-30-64

  122. 131 dewi rahayu November 26, 2013 at 7:34 am

    Asslammualaikm Wr.Wb.
    Pak, saya Dewi Rahayu klas G6 semester satu UNPAK,setelah membaca tentang Pengaruh Motivasi Dalam Peningkatan Kinerja.Saya berpendapat bahwa Motivasi is very2 important for our life. Dengan adanya Motivasi har pan tuk mencapai tujuan secara maksimal akan terwujud.
    Motivasi dapat timbul sejak bangun tidur kita menciptakan energi positif, dan kita berpola pikir secara positif pula.Motivasi dapat pula meniru dari Leader. Demikianlah pendapat saya.Thanks

  123. 132 Kilah November 26, 2013 at 2:07 pm

    Selamat malam pak…!

    Setelah membaca artikel bapak, yang berjudul: “Pengaruh Motivasi Terhadap Peningkatan Kinerja”. Ternyata memang betul motivasi sangat dibutuhkan oleh setiap individu, yaitu untuk menambah lebih bersemangat lagi dalam melakukan pekerjaannya sehari-harip. Oleh karena itu disetiap instansi perlu adanya motivasi, agar para karyawannya lebih bersemangat lagi dalam melakukan pekerjaannya, dengan adanya motivasi yang tinggi, maka insya Allah hasilpun akan lebih baik pula. Motivasi instrinsik timbul dari diri kita sendiri, yaitu ingin mencapai tujuan hidup yang lebih baik dan layak. Motivasi ekstrinsik timbul dari luar, misalnya dari atasan kita, dari keluarga, dari anak dari saudara kita dan sebagainya.

  124. 133 mufidah hairani November 28, 2013 at 8:54 am

    Selamat Siang pak Adie, Saya MUFIDAH HAIRANI mahasiswa UNPAK pascaadministrasipendidikan
    Sayasangatberterimakasihsudahdiperkenalkandengan blogs bapakini.Terutamamateri “PENGARUH MOTIVASI TERHADAP PENINGKATAN KINERJA” dalammateriinisayasangattertarikdengan 5 penelitimotivasi yang menghasilkan 5 teorimotivasiyaitu
    -TeoriEfek Hawthorn oleh Elton Mayo
    -TeoriKebutuhanoleh Abraham Maslow
    -Teori Xdan Y olehMcgregor
    -TeoriHyginedan Motivator olehHezberg
    -TeoriMotivasiBerprestasioleh David Mccelland
    Kelimateorimotivasidiatas, sayaterfokus di teoriX dan Y olehMcgregor yang menjelaskanbahwateori X = karyawantidaksukabekerjadanmenghindaripekerjaan,uangbukanmotivasi,karyawancenderungdiawasidengandisiplinketatdandiancamkeras, karyawantidakbolehmengembangkandiri.
    Dari Teori X mcgregoriniapakahperandari leader merekasangatdiperlukan?Atauhanyaterfokusdalamperaturan yang sudahberlakusebelumnyadengandisiplinygketatdandiwarnaiancamankeras, yang sudahtertanamdipikirandanmenjadikebiasaankaryawan.DalamlingkupkerjasepertiapapakTeori X inibanyakmendominasi? Denganpendekatankuratifdanantisipatifditerapkan, denganperan leader didalmnyaapakahkaryawanteori X bisamendekatikebiasaankaryawanTeori Y?
    Terimakasihpaksebelumnyasetelahmembacamaterimotivasibapakini, sayamenjadikanbeberapakalimatdanteori-teorididalamnyamenjadi motivator sayadalam memory pikiransayadanakansayaaplikasikandalamkehidupannyatatermasukmotivator dalammenyelesaikankuliahpascasayatepatwaktu….Aminnn.
    Npm : 072113021
    Kelas : A.I.1

  125. 134 wiwihilwiah December 19, 2013 at 3:18 am

    Assalamualaikum wr,wb
    Setelah saya membaca tulisan bapak mengenai pengaruh motivasi terhadap kinerja ,saya tertarik dengan teori motivasi berprestasi,dalam dunia pendidikan motivasi berperan sebagai pendorong yang menyebabkan adanya perubahan tingkah laku ke arah tujuan tertentu .dalam proses belajar motivasi intrinsik lebih menguntungkan karena dapat bertahan lebih lama ,kebutuhan untuk berprestasi yang bersifat intrinsik cenderung lebih stabil ,mereka berorientasi pada tugas tugas belajar yang memberikan tantangan.pendidik yang dapat mengetahui kebutuhan peserta didik untuk berprestasi dapat memanipulasi motivasi dengan memberikan tugas tugas yang sesuai untuk peserta didik.mohon maaf sebelimnya pak saya ingin bertanya,bagaimana kita dapat mengetahui sejauh mana motivasi anak didik kita untuk berprestasi dan bagaimana cara memberikan dorongan kpd mereka untuk selalu mempunyai motivasi untuk berprestasi di sekolah?.trimakasih sebelumnya.

    mahasiswa pasca sarjan Unpak
    semester 1 kls G6 Ciangsana

  126. 135 kilah December 19, 2013 at 8:11 pm

    Motivasi memang sangat dibutuhkan dalam kehidupan sehari hari, entah itu motivasi dari diri kita sendiri ( instinsik ) atau motivasi dari luar ( ekstrinsik ).tanpa adanya motivasi sulit untuk mencapai kehidupan yang layak

    G6 Ciangsana

  127. 136 wawan ridwan January 13, 2014 at 12:36 am

    warid s3 a4 unpak
    Assalaamu’alaikum wr.wb

    kata motivasi harus selalu melekat pada diri pimpinan yang berguna bagi peningkatan kinerja karyawannya ,namun hasilnya kadang tidak serempak ada yang maksimal yang belum maksimal sehingga tujuan visi dan misi dari suatu lembaga yang dalam hal ini terpikul pada tugas seorang pimpinan akan cukup lumayan berat.Saya mengucapkan banyak terima kasih kepada bapak yang telah menulis tentang pengaruh mitovasi terhadap peningkatan kinerja yang dalam hal ini menurut hasil penelitian motivasi kerja pada berbagai lembaga atau instansi sudah mulai berkurang .sekali lagi saya berharap tulisan bapak dapat dibaca dan dihayati sebagai pembendaharan dan pedoman baik bagi seorang pemimpin maupun calon pemimpin dalam hal ini karyawan .Kemudian saya mohon dibantu tentang referensi kualitas pelayanan pendidikan .terima kasih pa.semoga sukses selalu.

    Wasaalamu’alaikum wr.wb

  128. 137 Tati Ajeng Saidah February 3, 2014 at 1:11 am

    Assalamualaikum wr. wb
    Setelah saya membaca artikel yang Bapak tulis, saya setuju bahwa motivasi mempengaruhi kinerja. Ditempat saya mengajar, banyak guru senior yang sudah lama mengajar dengan masa kerja di atas 20 tahun tetapi kinerjanya sangat baik. Hal ini ditunjukkan dengan selalu datang tepat waktu, perhatian terhadap peserta didik dan melaksanakan tugas-tugas yang lainnya dengan baik. Sehingga bisa menjadi teladan bagi guru-guru lain yang masih muda, sayapun menjadi lebih termotivasi oleh mereka dan mencontoh sikap sikap yang baik dari mereka. Tetapi ada juga beberapa orang guru yang masih muda tetapi kinerjanya kurang baik. Hal ini bisa dilihat dari tingkal laku mereka yang selalu datang terlambat ataupun kalau ada jam mengajar tetapi malah mengobrol di ruang guru. Sayapun kurang senang dengan teman seperti itu, karena bisa berdampak buruk terhadap lembaga. Di rapat dinas, sering Kepala sekolah memberikan motivasi agar guru guru dapat melaksanakan tugasnya dengan sebaik-baiknya, tetapi mereka tetap saja kinerjanya masih kurang baik. Jadi saya lebih lebih setuju bahwa motivasi dari dalam diri sendiri (faktor internal) yang lebih banyak berperan dibandingkan dengan faktor eksternal.
    Saya senang membaca artikel yang Bapak tulis, sehingga bisa menambah wawasan dan menjadi motivasi bagi saya dalam melaksanakan pekerjaan sehari hari.
    Wassalamualaikum wr.wb

    Tati Ajeng Saidah
    Mahasiswa semester 1 Pasca Unpak jurusan AP kelas E.11
    NIM. 072113131

  129. 138 rionyrahayu February 3, 2014 at 9:26 am

    Assalamualaikum Wrwb. Setelah saya membaca makalah Bapak mengenai “Pengaruh Motivasi terhadap kinerja”, saya sangat setuju Pak. Motivasi sangat berpengaruh besar akan kinerja seseorang dalam menjalankan tugas dan tanggung jawab yang diembannya. sesuai dengan teori efek Hawtorn, motivasi bisa tercipta dari dalam diri (internal) dan dari luar/lingkungan (eksternal) seseorang. Motivasi dari dalam muncul karena adanya kebutuhan-kebutuhan dasar manusia sesuai dengan teori kebutuhan Maslow yaitu: kebutuhan fisiologis, kebutuhan rasa aman, kebutuhan sosial, kebutuhan harga diri, dan kebutuhan aktualisasi diri. Apabila semua kebutuhan dasar ini terpenuhi, maka motivasi berprestasi seseorang akan meningkat. Semakin kebutuhannya terpenuhi, maka akan semakin baik keadaan psikologis seseorang, semakin bahagia, dan orang tersebut pun pada akhirnya akan termotivasi untuk terus mengembangkan dirinya dengan terus berprestasi.
    Selain motivasi yang muncul dari dalam diri seseorang, motivasi juga muncul dari lingkungan eksternal seseorang. Teori Hygine dan Motivator menyatakan bahwa Faktor Hygine meliputi : kebijakan perusahaan dan sistem administrasinya, sistem pengawasan, gaya kepemimpinan, kondisi lingkungan kerja, serta hubungan antar pribadi akan menimbulkan kepuasan kerja seseorang, dan pada akhirnya kepuasan ini akan memotivasinya untuk melakukan upaya berprestasi yang lebih baik secara berkesinambungan.
    Ketika faktor internal dan eksternal seseorang sama-sama bernilai positif dan saling mendukung, maka motivasi kerja atau motivasi berprestasi seseorang akan semakin besar. Nah di sini lah peran seorang manajer atau pemimpin yang bermotivasi tinggi terhadap bawahan untuk terus berusaha mengakomodir semua pemenuhan kebutuhan serta pengusahaan lingkungan yang menyenangkan bagi para bawahannya. Contohnya seperti yang Bapak kemukakan pada teori pemenuhan kebutuhan, adanya upah/gaji yang layak, jaminan kesehatan, pemberian kesempatan pengembangan diri bawahan, pemberian reward untuk menghargai kinerja bawahan, serta penciptaan atmosfer kerja yang menyenangkan, baik, dan harmonis. Mengenai faktor internal dan eksternal dalam motivasi seseorang, saya berpendapat bahwa faktor internal lebih berpengaruh besar daripada faktor eksternal. Perasaan bahagia, nyaman/ketenangan bekerja, reward (pujian, hadiah, materi, kenaikan pangkat, piagam), jaminan kesehatan, jenjang karier yang jelas lebih efektif dalam meningkatkan motivasi berprestasi/kinerja seseorang, karena tidak adanya faktor keterpaksaan saat bekerja, dan akhirnya seseorang akan bekerja sepenuh hati. Jadi untuk terus meningkatkan motivasi dalam bekerja, kita bisa memulainya dari dalam diri kita sendiri. Wassalamualaikum Wrwb.

    Riony Rahayu, S.Pd
    Program studi Pasca Sarjana Administrasi Pendidikan
    Kelas E.11

  130. 139 Sri Sulastri February 3, 2014 at 4:51 pm

    Assalamu alaikum wr.wb
    Salam kenal Pak, Saya Sri Sulastri, mahasiswa Pascasarjana S2 UNPAK BOGOR jurusan AP kelas E.11
    Saya sangat tertarik dengan tulisan bapak tentang pengaruh motivasi terhadap peningkatan kinerja. Saya setuju dengan tulisan bapak bahwa tinggi rendahnya kinerja seseorang akan sangat dipengaruhi oleh tinggi rendahnya motivasi yang orang tersebut miliki. tidak dapat dipungkiri demikian besarnya pengaruh motivasi terhadap kinerja kita di sekolah atau di kantor, sehingga sangat perlu bagi kita untuk memelihara motivasi yang kita miliki, terutama motivasi yang sifatnya internal dari dalam diri kita (Internal Motivation). karena baik buruknya kinerja kita akan tergantung pada diri kita sendiri. Mungkin orang lain bisa memberi kita motivasi misalnya dengan memberikan saran-saran yang membangun untuk perbaikan kinerja kita, tapi kalau diri kita sendiri tidak mempunyai keinginan untuk memperbaiki diri atau menjaga motivasi kita tetap tinggi maka hal itu akan sia-sia saja.
    Misalkan di sekolah tempat saya mengajar, kepala sekolah selalu memotivasi para guru untuk tetap menjaga kinerja kita untuk memberikan pelayanan terbaik kepada siswa, dan hal tersebut selalu beliau sampaikan dalam setiap rapat dan pada kesempatan upacara. beberapa mempunyai pendapat yang sama dengan beliau tapi beberapa yang lainnya masih belum menyadari bahwa kinerja kita akan sangat berpengaruh pada keberhasilan proses belajar mengajar. walau bagaimanapun semua akan kembali pada individu masing-masing.
    Terima kasih Bapak hanya itu komentar yang bisa saya sampaikan semoga bermanfaat. Amin. tidak lupa saya ucapkan terima kasih atas tulisannya Alhamdulilah wawasan saya makin bertambah.

  131. 140 Nia Nuraeni February 3, 2014 at 6:32 pm

    Assalamualaikum wr. Wb
    Saya ucapkan terima kasih, karna artikel bapak yang berjudul ” Pengaruh Motivasi Terhadap Peningkatan Kinerja ” menambah wawasan bagi saya serta sangat menarik. Setelah membaca artikel tersebut, saya menyimpulkan bahwa motivasi memang memiliki pengaruh yang sangat penting terhadap peningkatan kinerja seseorang, baik itu yang sifatnya internal maupun yang sifatnya eksternal. Pada dasarnya setiap individu cenderung memiliki kinerja yang baik karna di pengaruhi oleh faktor – faktor kebutuhan fisiologisnya serta keinginan untuk di hargai dan mengembangkan potensi dalam dirinya ke arah yang lebih baik. Namun dalam hal ini, perlu adanya peran serta manajer dalam menciptakan lingkungan kerja yang kondusif dan membina kerjasama yang baik antar sesama pegawai sehingga terwujud rasa tanggung jawab yang tinggi serta memiliki komitmen dalam bekerja. Motivasi internal setiap individu berupa kesadaran diri terhadap tanggung jawab dan kewajiban merupakan inti utama yang perlu di miliki setiap pegawai. Namun dalam kenyataannya,Kesadaran diri tersebut muncul apabila kebutuhannya telah terpenuhi dan rasa di hargai atas segala pencapaian usahanya sehingga mampu meningkatkan kinerja yang lebih baik.
    Demikian comment dari saya, saya ucapkan terima kasih

    Nia Nuraeni ( Kelas E. 11)
    Mahasiswa Semester 1 Pasca Unpak
    NPM 72113123

  132. 141 sih mahanani February 4, 2014 at 1:12 am

    Assalamu’alaikum wr.wb
    Salam kenal buat pak Adie
    Setelah saya membaca tulisan bapak yang berjudul ” Pengaruh motivasi terhadap peningkatan kinerja “ada suatu hal yang menarik:
    Motivasi yang tinggi akan membuat kinerja menjadi baik,dan motivasi yang rendah membuat kinerja menjadi rendah pula.
    Setelah dihubungkan dengan situasi lingkungan tempat saya bekerja:
    guru yang mempunyai motivasi tinggi maka akan mempunyai kinerja tinggi pula yaitu tercermin guru tersebut peduli terhadap siswa dan maju mundurnya sekolah.Begitu sebaliknya dengan guru yang motivasinya rendah,maka akan mengurangi kinerjanya yaitu tidak ada kepedulian terhadap siswa maupun sekolah.Hanya mementingkan hal yang sifatnya pribadi saja yang penting hadir dan mengajar.
    Mungkin hanya ini komentar yang bisa saya berikan,semoga ada manfaatnya.Amin.
    Wassallamu’alaikum wr.wb
    Sih Mahanani
    Kelas E.11
    Mhs.smt 1 Pasca Sarjana UNPAK Bogor

  133. 142 hendra gunawan February 4, 2014 at 12:13 pm

    Assalamualaikum Wr.Wb.
    Pak, saya Hendra Gunawan mahasiswa Pasca Unv Pakuan Bogor kelas E-11.
    NPM : 072113113
    Semester 1 tahun 2013/2014
    Setelah membaca artikel bapak yang berjudul pengaruh motivasi terhadap kinerja, saya sependapat dengan apa yang bapak tulis, memang segala pekerjaan pada dasarnya harus ada apa yang namanya motivasi, karena dengan motivasi yang kuat apa yang kita kerjakan akan dilakukan dengan senang tanpa ada beban, jadi motivasi adalah dorongan dari dalam diri manusia untuk mencapai tujuan seperti dikutip dari tulisan bapak “Motivasi sebagai upaya yang dapat memberikan dorongan kepada seseorang untuk mengambil suatu tindakan yang dikehendaki, sedangkan motif sebagai daya gerak seseorang untuk berbuat. Karena perilaku seseorang cenderung berorientasi pada tujuan dan didorong oleh keinginan untuk mencapai tujuan tertentu”.
    Oleh karena itu jika seseorang kinerjanya sangat kuat atau tinggi berarti motivasinya tinggi pula begitu juga sebaliknya jika kinerjanya lemah berarti motivasinya juga lemah bahkan tidak menutup kemungkinan tidak ada motivasi sama sekali. Seperti teori kebutuhan yang dikemukan oleh Abraham Maslow, setiap manusia bekerja untuk memenuhi kebutuhan hidupnya seperti Kebutuhan fisiologis, Kebutuhan rasa aman, Kebutuhan social, Kebutuhan harga diri, dan Kebutuhan aktualisasi diri. Karena kebutuhan-kebutuhan tersebut bersifat hierarkis, yaitu suatu kebutuhan akan timbul apabila kebutuhan dasar sebelumnya telah dipenuhi. Contoh Setelah kebutuhan fisiologis terpenuhi seperti pakaian, makanan dan perumahan, maka kebutuhan tersebut akan digantikan dengan kebutuhan lainnya seperti rasa aman dan seterusnya.
    Sehingga tingkat kebutuhan setiap manusia/seseorang akan berbeda-beda, hal ini yang mempengaruhi dalam bekerja. Jika Seseorang yang kebutuhan hanya sekedar untuk memenuhi kebutuhan fisiologisnya saja makan, maka pekerjaan yang dilakukannya hanya untuk memenuhi kebutuhan tersebut saja.
    Demikian komentar yang dapat sampaikan, mudah-mudahan dapat bermanfaat untuk kita semua. Amiiin.
    Wassalamualaikum Wr. Wb

  134. 143 sih mahanani February 4, 2014 at 12:34 pm

    Assalamu’alaikum wr.wb
    Salam kenal buat pak Adie
    Saya Sih Mahanani mahasiswa semester 1 kelas E.11 Pasca Sarjana UNPAK Bogor.
    Setelah membaca tulisan bapak yang berjudul ” Pengaruh motivasi terhadap peningkatan kinerja “ada suatu hal yang menarik :
    seseorang yang mempunyai motivasi tinggi akan mempunyai peningkatan kinerja yang tinggi dan seseorang yang mempunyai motivasi rendah akan rendah pula peningkatan kerjanya.
    Setelah saya padukan dengan situasi kerja yang ada di tempat saya bekerja :
    guru yang motivasinya tinggi akan peduli terhadap siswa dan maju mundurnya sekolah,sedangkan guru yang motivasinya rendah hanya mementingkan kepentingannya sendiri yang penting hadir di sekolah dan mengajar.
    Mungkin hanya itu komentar saya,semoga ada manfaatnya.Terimakasih.
    Wassalamu’alaikum wr.wb

  135. 144 Dadun Abdul Manaf February 5, 2014 at 1:34 am

    Assalamualaikum wr.wb
    pekerjaan akan menghasilkan suatu hasil yang baik ketika dikerjakan dalam kondisi yang nyaman, aman dan penuh motivasi, motivasi bisa muncul dari eksternal dan internal.
    faktor eksternal yang mempengaruhi seperti lingkungan kerja yang kondusif,prestasi kerja yang dihargai, gaji yang memadai sesuai dengan aturan yang berlaku dan jaminan kerja yang bagus baik untuk pekerja ataupun kelurganya, sedangkan faktor internal yang mempengaruhi adalah faktor yang muncul dari diri pekerjanya itu sendiri, seperti kesadaran bahwa dirinya adalah seorang hamba allah yang ketika dia mendapat amanah akan memberikan yang terbaik kepada yang telah memberikan amanah, termasuk menyakini bahwa mencari rizki untuk memenuhi kebutuhan keluarga dengan jerih panyah sendiri merupakan aktivitas yang akan mendapat pahala yang luar biasa disisi Allah swt.
    faktor internal inilah yang harus ada pada setiap orang sehingga motivasi kerjanya akan senantiasa stabil dan terjaga serta bekerja akan penuh dedikasi, ikhlas serta tidak menghalalkan segala cara.
    Dadun Abdul Manaf,
    Npm : 72113159
    jurusan AP, semester 1 kelas sukabumi

  136. 145 NENENG NURMILAH February 5, 2014 at 3:32 am

    Assalamu’alaikum wr.wb.
    Setelah membaca tulisan bapak tentang “pengaruh motivasi terhadap kinerja”, saya berpendapat bahwa motivasi sangat penting dimiliki oleh seseorang dalam meningkatkan prestasi kinerjanya, terutama “SELF MOTIVATION” yaitu motivasi atau dorongan dari dalam diri sendiri. sesorang yang memiliki self motivation yang tinggi tidak akan mudah menyerah dan frustasi apabila hasil dari kerjanya tidak sesuai dengan yang diharapkan, sebaliknya dia akan terus berusaha bangkit dan berusaha memperbaiki terus sampai berhasil.Dan kepuasan yang tinggi akan dirasakannya apabila dia sukses, dan dapat berbagi dan memberikan motivasi kepada temannya.
    selain “SELF MOTIVATION”, motivasi dari orang lain atau dari luar pun sangat diperlukan dalam meningkatkan prestasi kinerja. Adapun motivasi dari luar tersebut bisa berupa motivasi dari keluarga, teman dekat, atasan teman sejawat ataupun dari lingkungannya, sebagaimana hal tersebut sudah dibahas secara rinci dalam tulisan bapak. terima kasih.

    NIM. 072113022
    KELAS E.11

  137. 146 Iceu Aminah February 5, 2014 at 10:41 am

    Assalamualikum Wr.Wb. Alhamdulillah saya telah baca tulisan,Bapa ,
    sangat menarik dan bagus mudah-mudahan para manajer dan pimpinan
    perusahaan atau pimpinan lembaga. ikut membaca pula. Motivasi memang merupakan suatu yang dpat memberikan energi kepada seseorang untuk mencapai segala apa yang dibutuhkannya, apa yang akan dan ingin dicapainya. Bahkan untuk bertahan hidup pun bila seseorang tengah mengalami sakit parah perlu memiliki motivasi hidup terutama motivasi dari dalam dirinya sendiri.
    Bagi pencapaian sesautu kebutuhan dan prestasi kerja motivasi ibarat ruhnya. Motivasi eksternal tidak banyak berpengaruh atau hanya berifat temporer tanpa didasari motivasi internal . Terutama bagi profesi guru motivasi dalam dirilah yang akan menuntun kepada keberhasilan anak didik kita. Karena guru yang benar-benar memiliki motivasi dalam mencerdaskan bangsa pasti memiliki motivasi berupa keihklasan. Memang benar peningkatan kesejahteraan harus terus diperjuangkan , tetapi dusamping motivasi eksternal tersebut yang utama bagi seorang guru adalah motivasi internal untuk kemajuan anak didiknya.
    mudah-mudahan an komentar saya bisa nyambung dengan tulisan bapak.
    Wassalamualaikum Wr.Wb. .

    nama: Iceu Aminah
    kelas E 11.
    Mhs.smt 1 Pasca Sarjana UNPAK Bogor

  138. 147 lusie dewi kusumawati February 6, 2014 at 6:44 am

    Assalamualaikum Wr.Wb
    Saya Lusie Dewi Kusumawati
    Kelas E11
    Npm. 72113121

    Motivasi adalah dorongan dari diri individu untuk memenuhi kebutuhan yang berorientasi pada tujuan. Motivasi dapat mendorong seseorang untuk melaksanakan suatu pekerjaan dengan sebaik-baiknya bahkan ingin mencapai kesuksesan yang lebih baik dari orang lain.
    Timbulnya motivasi dapat berasal dari diri sendiri (intrinsik) atau dari luar diri kita (ekstinsik).
    Pada peserta didik motivasi intrinsik dapat berupa perasaan menyenangi materi dan kebutuhan pada materi tersebut, misalnya untuk kebutuhan masa depan siswa yang bersangkutan. Sedangkan motivasi ektrinsik dapat berupa pujian dan hadiah, suri tauladan dari orang tua dan guru. Kekurangan atau ketiadaan motivasi baik secara intrinsik maupun ektrinsik dapat menyebabkan kurang bersemangatnya siswa dalam melakukan proses belajar baik di sekolah maupun di rumah dari sudut pandang motivasi yang ditimbulkan, motivasi yang lebih signifikan adalah motivasi intrinsik karena lebih murni dan lebih langgeng serta tidak bergantung pada dorongan dan pengaruh orang lain. Seberapa kuat motivasi yang dimiliki individu akan banyak menetukan kualitas perilaku yang ditampilkan.
    Dalam dunia pendidikan peran guru adalah sebagai motivator bagi peserta didik. Guru sebagai pendidik maupun pengajar merupakan faktor penentu kesuksesan usaha pendidikan. Tetapi dalam kenyataannya masih banyak pendidik yang kurang mempunyai motivasi dalam hubungannya dengan pekerjaan. Faktor yang mempengaruhinya dapat berupa; kondisi pekerjaan, kurangnya pengakuan diri, hubungan sosial. Kondisi semacam itu secara tidak langsung dapat berpengaruh pada peserta didik. Akan tetapi sebagai seorang pendidik seyogianya kita dapat menghilangkan rasa ketidaknyamanan tersebut dengan memunculkan kembali potensi yang ada dalam diri semaksimal mungkin. Kendala yang dihadapi menjadi tantangan untuk meningkatkan kinerja yang lebih baik. Jika kita ikhlas semuanya akan menjadi lebih mudah untuk dijalaninya. InsyaAllah.

    Wassalamualaikum Wr. Wb

  139. 148 Dadan Candra February 7, 2014 at 4:05 am

    Assalamualaikum wr..wb..

    Alhamdulilah setelah saya membaca dan menyimak tulisan bapak tentang “Pengaruh Motivasi terhadap Peningkatan Kinerja” semakin menambah wawasan pengetahuan tentang motivasi, sehingga saya berpendapat bahwa motivasi memang sangat dibutuhkan dan sangat berpengaruh dalam mendorong seseorang atau karyawan untuk bekerja menjadi lebih baik.
    Seperti kita ketahui bahwa motivasi bisa timbul dari diri sendiri bisa juga kita peroleh dari lingkungan dimana kita bekerja misalnya dari rekan kerja bahkan mungkin dari atasan ataupun pimpinan.
    Motivasi yang datang dari diri sendiri tidak terlepas dari tiga macam kebutuhan yaitu :
    – Kebutuhan untuk mencapai prestasi (Achievement motivation) .
    – Kebutuhan berkuasa (Power motivation) yang persaingan dan mempengaruhi orang lain
    - Kebutuhan berafiliasi (Affiliation motivation) yang meliputi persahabatan, kerjasama dan perasaan diterima. Sementara motivasi yang kita peroleh dari rekan kerja ataupun pimpinan dapat memberikan dorongan seseorang untuk mengambil suatu tindakan yang diharapkan dan prestasi kerja yang memuaskan. Tanpa adanya motivasi seseorang tidak akan mencapai tujuannya dalam bekerja, oleh karena itu motivasi menjadi sangat penting untuk keberhasilan seseorang atau kelompok untuk mencapai tujuannya.
    Demikian komentar dari saya, semoga bermanfaat untuk kita semua amiin.
    Wassalamualaikum wr..wb..

    Dadan Candra
    Pasca Sarjana Jurusan Administrasi Pendidikan
    Kelas E.11
    Universitas Pakuan Bogor

  140. 149 Dudi Almunadi February 7, 2014 at 6:57 am

    Assalamualaikum Wr Wb
    secara awam saya megetahui bahwa manusia butuh motivasi terutama dalam bekerja ataupun belajar, namun melalui artikel bapak, sy baru mengetahui bahwa apa itu motivasi secara ilmiyah, bahkan saya baru membaca/mengetahui beberapa teori motivasi yang bapak tulis pd blog bapak, kemudian bagaimana teknik memotivasi kerja, mudah2an saya bisa menjadi motivator bagi rekan sejawat atau pun (minimal) bagi saya sendiri. indikasi pegawai yang termotivasi dengan baik maupun buruk menjadi masukan bagi saya untuk mengukur diri saya sendiri (karna saya baru mau mencoba diri sendiri sebagai objek).
    mudah2an semakin banyak artikel yang bapak tulis hingga bisa menjadi bahan masukan/pelajaran bagi kami.
    thank you so much

    Dudi Almunadi (mahasiswa pascasarjan UNPAK Bogor)
    NIM :72113110
    kelas : E.11

  141. 150 AGUS GUNAWAN-pasca Sarjana UNPAK February 7, 2014 at 10:29 am

    Assalamu’alaikum Wr. Wb.
    Setelah saya membaca isi dari tulisan jurnal bapak, saya ingin memberi komentar sebagai berikut :
    1. Memang benar Motivasi adalah landasan utama manusia dalam melakukan suatu perbuatan. Dorongan ini akan muncul jika terdapat pengaruh atau rangsangan dari luar. Walaupun hal ini tidak dipungkiri pada diri manusia telah terdapat potensi akal yaitu berfikir tentang apa yang harus dilakukan. Misalnya ketika dorongan ini muncul secara alami seperti rasa lapar maka manusia akan berusaha untuk memenuhi rasa laparnya dengan makan atau mencari sesuatu untuk dimakan. Namun ketika dorongan atau motivasi ini hasil dari proses belajar hasil proses bekerja atau pengalaman hidup dimana semua ini didapatkan dari luar (faktor eksternal) maka manusia pun akan berusaha mencapai suatu tujuan yang diinginkan. Oleh karena itu korelasi antara motivasi, upaya dan tujuan merupapakan hal yang tak bisa dipisahkan. Seperti pemaparan pada tulisan bapak bahwa Tujuan sangatlah berpengaruh pada manusia ketika melakukan pekerjaan dengan motivasi atau tanpa motivasi. Ketika kita memiliki suatu tujuan dan tujuannya adalah positif misalnya membangun karakter manusia pada peserta didik kita, maka seorang guru akan termotivasi atau terdorong mengerahkan segala upayanya (baca:kinerja) dengan baik sesuai dengan tujuan yang akan dicapai. Begitupun ketika seorang guru memiliki tujuan pembelajaran tertentu yang akan diajarkan pada peserta didiknya maka guru akan termotivasi untuk mencari banyak referensi serta khazanah ilmu yang lain dalam rangka mendukung terhadap tercapainya tujuan pembelajaran tema tertentu. Sehingga akan didiapati pada pribadi seperti ini motivasi yang tinggi karena memiliki tujuan yang tergambar jelas apa yang akan dicapai, dan langkah serta upaya realistis yang dapat dilakukan dalam mewujudkan tujuan tersebut. Sehingga Motivasi sangatllah berpengaruh terhadap kualitas kinerja seseorang.
    2. Motivasi ini akan berbeda-beda pada diri manusia tergantung sudut pandang serta pandangan hidupnya mengenai sesuatu. Misalnya ada yang menjadikan tujuan yang bersifat materil maupun non materil maka motivasi ini akan menyesusikan. sesuai dengan tujuan yang akan dicapai. Maka akan didapatkan sifat dan sikap positif bagi seseorang yang memiliki tujuan serta motivasi yang dimiliki. seperti rasa senang ketika mengerjakan suatu pekerjaan, rasa puas dan rela mengorbankan segala daya upaya semata-mata rasa tanggungjawab terhadap kerja yang telah diterima sebagai kesempatan yang patut untuk disyukuri.
    Demikian hal yang dapat saya sampaikan, mohon maaf atas segala hal yang kurang berkenan, semoga bermanfaat.

    Nama : Agus Gunawan,S.S
    Kelas : E.11
    Pasca Sarjana UNPAK

  142. 151 Yuliana February 7, 2014 at 12:38 pm

    Assalamualaikum Warohmatullahi Wabarokatuh. Perkenalkan nama saya Yuliana, NIM 72113133, Kelas E.11.
    Bahwa saya setuju dengan apa yang di paparkan dalam tulisan “ PENGARUH MOTIVASI TERHADAP PENINGKATAN KINERJA “ yang di susun oleh Dr. H. Adie yusuf, S.pd. MA.
    Namun dalam organisassi lembaga pendidikan tempat saya bekerja masih di temukan permasalah – permasalahan seperti :
    1. Kekuatan untuk menggerakan seseorang sehingga para pendidik belum sepenuhnya untuk mempunyai kinerja yang optimal, sehingga arti motivasi sebagai sesuatu kekuatan sumber daya yang menggerakan masih kurang di rasakan.
    2. Dalam teori x “ Karyawan tidak suka bekerja dan cenderung untuk menghindari kerja” Di lingkungan pendidikan, masih bnyak tenaga tenaga pengajar yang belum terbagi dalam bidang pekerjaan tertentu dalam arti beban kerja hanya di berikan kepada orang orang senior saja, jadi besar kemungkinan orang orang tersebut menghindari pekerjaan itu di akibatkan karena tidak di beri kesempatan untuk memegang jabatan atau pekerjaan tertentu di luar mengajari karena selain mengajar bagi pendidik atau pengajar ada tugas-tugas lain.
    Untuk permasalahan tersebut yang perlu di lakukan adalah sperti berikut antara lain :
     Perlu sekali daya gerakan atau motivasi dari berbagai factor antara lain seperti factor dalam diri dan factor lingkungan pekerjaan itu sendiri. Faktor dalam diri sudah tertanam dan akan bersinergi dengan komponen komponen lain yang menggerakan terutama lingkungan pekerjaan, seperti pengawasan, bersahabat dan ada rasa saling menghargai dari seluruh komponen yang terlibat, sehingga kwalitas dan kinerja akan tercapai sesuai dengan tujuan lembaga pendidikan.
     Untuk menjadikan guru berprestasi di kelas masih belum ada peningkatan seperti misalnya sosialisasi kurikulum 3013 masih belum terlaksana dan kurikulum yang lama pun para pendidik belum mahir atau belum mampu mendisain dan penerapannya di dalam kelas belum mencapai kwalitas yang memuaskan, karena selama system antara proses dan evaluasi tidak seimbang anak dituntut mampu berfikir kognitif sedang dalam proses KBM kurikulum mengharapkan kompetensi sikap dan skill sedangkan hasil akhir proses pembelajaran ditutup dengan evaluasi ujian nasional. Ujian nasional yang menuntut berfikir kognitif. Yang harus dilakukan antara lain dalam permasalahan tersebut:
    1) Memberikan kesempatan berprestasi kepada guru untuk kompetensi-kompetensi yang dimiliki pendidik atau guru sesuai dengan keprofesionalannya serta memberi kesempatan untuk mengikuti lomba-lomba yang menuntut guru menambah wawasan. Kesempatan itu setidaknya diberikan baik oleh pimpinan lembaga atau oleh lembaga-lembaga lain yang terkait di dalam bidangnya.
    2) Segenap lembaga mendukung sepenuhnya untuk memberi kesempatan pada guru supaya berprestasi.
    3) Lingkungan kerja yang efektif dan kondusif sehingga memotifasi kinerja yang akhirnya untuk mencapai tujuan pendidikan yang diharapkan.

    Sekian komentar dari saya, sebelumnya mohon maaf apabila dalam paparan ini banyak kesalahan yang diakibatkan kurang wawasan dan pengetahuan yang saya miliki. WABILLAHI TAOFIK WALHIDAYAH WASSALAMUALAIKUM WARRAHMATULLAHI WABARAKATUH.

  143. 152 IIS SUKAESIH February 7, 2014 at 12:55 pm

    Assalamualaikum Wr,Wb.

    Saya Iis Sukaesih
    Kelas . E 11 /AP
    NPM . 072113116

    saya sangatlah setuju dengan motivasi diatas karerna dalam suatu kehidupan yang kita jalani diperlukan sebuah motivasi untuk mendorong keinginan kita untuk lebih maju ke depan dibandingkan dengan saat ini. Sebuah kata motivasi mampu membuat seseorang menjadi lebih semangat dan optimis dalam menjalani kehidupan yang penuh dengan cobaan ini. Untuk itu diperlukan motivasi yang kuat agar dapat meningkatkan kinerja yang membuat semangat kita semakin membara dan tidak mudah menyerah ketika menghadapi kesulitan karena memiliki motivasi yang baik.

    sedikit Kata Motivasi yang bisa saya tambahkan :

    Kualitas dari kehidupan seseorang itu tergantung pada komitmennya utk berhasil, bidang apapun yg dia tempuh.

    Orang yg berjaya dalam hidup adalah orang yg nampak tujuannya dengan jelas & menjurus kepadanya tanpa menyimpang.

    Jangan membuang waktu dgn terus bersedih.. Terus melarutkan diri dlm kesedihan hanya akan menghambat pertumbuhan “kebahagiaan”.

    Jangan menuntut ingin dicintai apa adanya jika kamu masih memberi syarat kepada seseorang yang mencintaimu.

    Kegagalan memang batu sandungan yang cukup menyakitkan, tapi bukan juga hal yang dapat menghapus keberhasilan

    Sikap adalah perbuatan yang simpel namun akan bisa membuat perbedaan yang besar

    Larut dalam kesedihan tidak akan bisa membuatmu bangkit, hapus air matamu dan segera bergerak maju

    Seberat apapun harimu, jangan pernah biarkan seseorang membuatmu merasa bahwa kamu tidak apntas mendapat apa yang kamu inginkan

    Terkadang kejujuran bisa menyakiti, tetapi percayalah masalah apapun akan cepat terselesaikan jika kamu berlaku jujur.

    Seseorang dgn wawasan yg cukup untuk mengakui kekurangannya berada paling dekat dgn kesempurnaan.

    Banyak kegagalan dalam hidup ini dikarenakan orang2 tidak menyadari betapa dekatnya mereka dengan keberhasilan saat mereka menyerah.

    Tidak ada yang bisa mengendalikanmu, semua tergantung pada diri kita sendiri. Orang lain hanya bisa mempengaruhi.

    Kesalahan yang pernah kamu alami akan membuat kamu lebih dewasa, berbuatlah lebih baik dari kesalahan yang telah kamu buat

    Salah satu kepuasan yang paling besar dalam kehidupan adalah mengatasi masalah dengan cara efisien dan lebih baik

    Tuhan telah merancang kesuksesan setiap manusia, jangan ragu untuk mendekati-Nya agar mendapatkan limpahan keskusesan yang besar darinya kesempatan kamu untuk sukses di setiap kondisi akan dapat diukur oleh seberapa besar kepercayaan kamu pada diri sendiri

    Jalan kesuksesan tiap orang berbeda-beda dan tidak perlu silau jika meihat kesuksesan orang lain

    Di atas adalah kata motivasi yang juga bisa dijadikan sebuah motivasi untuk menjalani kehidupan yang penuh dengan cobaan ini. Banyak makna yang terkandung dalam kata motivasi, namun pada intinya setiap motivasi pasti mendorong kita untuk menjadi pribadi yang lebih baik dari yang sebelumnya.

    terimakasih banyak pak atas postingan nya yang sangatlah membantu.

  144. 153 Aang Muslimin February 7, 2014 at 1:37 pm

    Assalamualaikum wr.wb
    Setelah saya membaca tulisan Bapak yang bertema “Pengaruh Motivasi terhadap peningkatan kinerja” , maka saya sangat tertarik untuk memberikan komentar terhadap motivasi dan hubungannya dengan kinerja yang ada di tempat kerja kami, yaitu di sekolah. Banyak permasalahan di tempat kerja kami antara lain: banyaknya karyawan TU yang datang terlambat hingga yang tidak masuk berminggu- minggu tanpa keterangan yang jelas. Rendahnya kinerja karyawan TU di sekolah kami mungkin disebabkan seperti yang dijelaskan dalam tulisan Bapak di atas yaitu kurangnya motivasi atau daya dorong untuk mencapai satu tujuan. Lebih spesifik lagi akibat rendahnya motivasi internal dari dalam diri karyawan tersebut meskipun gaji mereka sudah dinaikkan. Apalagi dalam sistem penggajian di PNS yang tidak berorientasi pada kinerja. Sehingga motivasi dalam bekerja yang rendah, bersifat afatis, masa bodoh diperparah oleh otda yang membuat jabatan-jabatan fungsional bukan berorientasi pada kompetensi tapi sebaliknya menjadi jabatan yang bersifat politis. Demikian komentar dari saya , mohon maaf bila ada kesalahan dalam komentarnya. Wassalamualaikum wr.wb.
    Aang Muslimin
    Mahasiswa S-2 UNPAK, Manajemen Pendidikan
    Semester I
    Kelas E.11
    NIM 072113105

  145. 154 aangmuslimin February 7, 2014 at 1:52 pm

    Assalamualaikum wr.wb
    Setelah saya membaca tulisan Bapak yang bertema “Pengaruh Motivasi terhadap peningkatan kinerja” , maka saya sangat tertarik untuk memberikan komentar terhadap motivasi dan hubungannya dengan kinerja yang ada di tempat kerja kami, yaitu di sekolah. Banyak permasalahan di tempat kerja kami antara lain: banyaknya karyawan TU yang datang terlambat hingga yang tidak masuk berminggu- minggu tanpa keterangan yang jelas. Rendahnya kinerja karyawan TU di sekolah kami mungkin disebabkan seperti yang dijelaskan dalam tulisan Bapak di atas yaitu kurangnya motivasi atau daya dorong untuk mencapai satu tujuan. Lebih spesifik lagi akibat rendahnya motivasi internal dari dalam diri karyawan tersebut meskipun gaji mereka sudah dinaikkan. Apalagi dalam sistem penggajian di PNS yang tidak berorientasi pada kinerja. Sehingga motivasi dalam bekerja yang rendah, bersifat afatis, masa bodoh diperparah oleh otda yang membuat jabatan-jabatan fungsional bukan berorientasi pada kompetensi tapi sebaliknya menjadi jabatan yang bersifat politis. Demikian komentar dari saya , mohon maaf bila ada kesalahan dalam komentarnya. Wassalamualaikum wr.wb.
    Aang Muslimin
    Mahasiswa S-2 UNPAK, Manajemen Pendidikan
    Semester I
    Kelas E.11
    NIM 072113105

  146. 155 Yuliana February 7, 2014 at 2:00 pm

    Assalamualaikum Warohmatullahi Wabarokatuh. Perkenalkan nama saya Yuliana, NIM 72113133, Kelas E.11.
    Bahwa saya setuju dengan apa yang di paparkan dalam tulisan “ PENGARUH MOTIVASI TERHADAP PENINGKATAN KINERJA “ yang di susun oleh Dr. H. Adie yusuf, S.pd. MA.
    Namun dalam organisassi lembaga pendidikan tempat saya bekerja masih di temukan permasalah – permasalahan seperti :
    1. Kekuatan untuk menggerakan seseorang sehingga para pendidik belum sepenuhnya untuk mempunyai kinerja yang optimal, sehingga arti motivasi sebagai sesuatu kekuatan sumber daya yang menggerakan masih kurang di rasakan.
    2. Dalam teori x “ Karyawan tidak suka bekerja dan cenderung untuk menghindari kerja” Di lingkungan pendidikan, masih bnyak tenaga tenaga pengajar yang belum terbagi dalam bidang pekerjaan tertentu dalam arti beban kerja hanya di berikan kepada orang orang senior saja, jadi besar kemungkinan orang orang tersebut menghindari pekerjaan itu di akibatkan karena tidak di beri kesempatan untuk memegang jabatan atau pekerjaan tertentu di luar mengajari karena selain mengajar bagi pendidik atau pengajar ada tugas-tugas lain.
    Untuk permasalahan tersebut yang perlu di lakukan adalah sperti berikut antara lain :
     Perlu sekali daya gerakan atau motivasi dari berbagai factor antara lain seperti factor dalam diri dan factor lingkungan pekerjaan itu sendiri. Faktor dalam diri sudah tertanam dan akan bersinergi dengan komponen komponen lain yang menggerakan terutama lingkungan pekerjaan, seperti pengawasan, bersahabat dan ada rasa saling menghargai dari seluruh komponen yang terlibat, sehingga kwalitas dan kinerja akan tercapai sesuai dengan tujuan lembaga pendidikan.
     Untuk menjadikan guru berprestasi di kelas masih belum ada peningkatan seperti misalnya sosialisasi kurikulum 3013 masih belum terlaksana dan kurikulum yang lama pun para pendidik belum mahir atau belum mampu mendisain dan penerapannya di dalam kelas belum mencapai kwalitas yang memuaskan, karena selama system antara proses dan evaluasi tidak seimbang anak dituntut mampu berfikir kognitif sedang dalam proses KBM kurikulum mengharapkan kompetensi sikap dan skill sedangkan hasil akhir proses pembelajaran ditutup dengan evaluasi ujian nasional. Ujian nasional yang menuntut berfikir kognitif. Yang harus dilakukan antara lain dalam permasalahan tersebut:
    1) Memberikan kesempatan berprestasi kepada guru untuk kompetensi-kompetensi yang dimiliki pendidik atau guru sesuai dengan keprofesionalannya serta memberi kesempatan untuk mengikuti lomba-lomba yang menuntut guru menambah wawasan. Kesempatan itu setidaknya diberikan baik oleh pimpinan lembaga atau oleh lembaga-lembaga lain yang terkait di dalam bidangnya.
    2) Segenap lembaga mendukung sepenuhnya untuk memberi kesempatan pada guru supaya berprestasi.
    3) Lingkungan kerja yang efektif dan kondusif sehingga memotifasi kinerja yang akhirnya untuk mencapai tujuan pendidikan yang diharapkan.

    Sekian komentar dari saya, sebelumnya mohon maaf apabila dalam paparan ini banyak kesalahan yang diakibatkan kurang wawasan dan pengetahuan yang saya miliki.


  147. 156 Sri Ayunda February 7, 2014 at 3:45 pm

    Assalamualaikum Warohmatullahi Wabarokatuh. Nama saya Sri Ayunda; NIM. 72113128; Kelas E.11
    Motivasi merupakan faktor pendorong seseorang menuju suatu kinerja yang baik. Motivasi itu timbul dari dalam diri sendiri/internal dan eksternal/seperti teman dekat,atasan dari dan lingkungan masyarakat. Permasalahan yang terjadi di lingkungan kerja saya ketika seorang guru merasa jenuh dengan lingkungan kerjanya karena terlalu lama masa kerja bertugas atau ada permasalahan yang timbul di luar sekolah atau keluarga. Saya setuju dengan pendapat Bapak bahwa seorang pemimpin yang mempunyai kinerja yang baik akan membantu bawahannya untuk membangkitkan motivasi kerja yang lebih baik, diantaranya yaitu:
    1. Memberikan motivasi juga arahan-arahan yang jelas.
    2. Memfasilitasi dengan menggunakan teknologi sehingga dalam melaksanakan tugas menjadi mudah.
    3. Memberikan briefing setiap satu bulan sekali untuk menyamakan persepsi.
    4. Melaksanakan pelatihan atau workshop supaya ada pencerahan dan menambah wawasan untuk melaksanakan tugas lebih baik.
    Komentar menurut teori X
    “Karyawan harus diawasi dan diancam agar mau bekerja dengan baik”. Saya berpendapat pengawasan dengan baik perlu bagi suatu terlaksananya proses bekerja namun secara personal pengawasan atau diawasi dengan ketat rasanya tidak perlu karena akan membuat beban mental bagi karyawan atau pegawai itu. Tumbuhnya kinerja seseorang bukan dari ancaman tetapi salah satu yang menumbuhkannya adalah dengan pemberian reward, dan bentuk ancaman tersebut sudah tidak sesuai lagi dengan sikap menghargai terhadap manusia atau melanggar hak asasi manusia.
    Komentar Menurut teori Y
    “Seorang karyawan ada kebebasan dalam melaksanakan tugasnya, ada kebebasan untuk mengemukakan ide atau gagasannya tanpa ada pengawasan dan aturan-aturan yang jelas”. Saya berpendapat bahwa pengawasan dan hukuman itu perlu, namun tingkat pengawsan dan hukuman tersebut disesuaikan dengan aturan-aturan atau kode etik dalam lembaga pendidikan atau dalam lembaga lain, sehingga karyawan dalam melaksanakan tugasnya tidak semena- mena atau membuat aturan sendiri-sendiri. Langkah yang harus diambil bahwa seorang karyawan harus tetap melaksanakan tugas kerjanya dengan baik dan sesuai dengan aturan-aturan yang berlaku..
    Wassalamualaikum Warohmatullahi Wabarokatuh.

    Assalamualaikum Warohmatullahi Wabarokatuh. Nama saya Sri Ayunda; NIM. 72113128; Kelas E.11
    Motivasi merupakan faktor pendorong seseorang menuju suatu kinerja yang baik. Motivasi itu timbul dari dalam diri sendiri/internal dan eksternal/seperti teman dekat,atasan dari dan lingkungan masyarakat. Permasalahan yang terjadi di lingkungan kerja saya ketika seorang guru merasa jenuh dengan lingkungan kerjanya karena terlalu lama masa kerja bertugas atau ada permasalahan yang timbul di luar sekolah atau keluarga. Saya setuju dengan pendapat Bapak bahwa seorang pemimpin yang mempunyai kinerja yang baik akan membantu bawahannya untuk membangkitkan motivasi kerja yang lebih baik, diantaranya yaitu:
    1. Memberikan motivasi juga arahan-arahan yang jelas.
    2. Memfasilitasi dengan menggunakan teknologi sehingga dalam melaksanakan tugas menjadi mudah.
    3. Memberikan briefing setiap satu bulan sekali untuk menyamakan persepsi.
    4. Melaksanakan pelatihan atau workshop supaya ada pencerahan dan menambah wawasan untuk melaksanakan tugas lebih baik.
    Komentar menurut teori X
    “Karyawan harus diawasi dan diancam agar mau bekerja dengan baik”. Saya berpendapat pengawasan dengan baik perlu bagi suatu terlaksananya proses bekerja namun secara personal pengawasan atau diawasi dengan ketat rasanya tidak perlu karena akan membuat beban mental bagi karyawan atau pegawai itu. Tumbuhnya kinerja seseorang bukan dari ancaman tetapi salah satu yang menumbuhkannya adalah dengan pemberian reward, dan bentuk ancaman tersebut sudah tidak sesuai lagi dengan sikap menghargai terhadap manusia atau melanggar hak asasi manusia.
    Komentar Menurut teori Y
    “Seorang karyawan ada kebebasan dalam melaksanakan tugasnya, ada kebebasan untuk mengemukakan ide atau gagasannya tanpa ada pengawasan dan aturan-aturan yang jelas”. Saya berpendapat bahwa pengawasan dan hukuman itu perlu, namun tingkat pengawsan dan hukuman tersebut disesuaikan dengan aturan-aturan atau kode etik dalam lembaga pendidikan atau dalam lembaga lain, sehingga karyawan dalam melaksanakan tugasnya tidak semena- mena atau membuat aturan sendiri-sendiri. Langkah yang harus diambil bahwa seorang karyawan harus tetap melaksanakan tugas kerjanya dengan baik dan sesuai dengan aturan-aturan yang berlaku..
    Wassalamualaikum Warohmatullahi Wabarokatuh.

  148. 157 dedeh septy February 7, 2014 at 4:25 pm

    Assalamualaikum wr.wb
    Setelah sy membaca artikel bapak tentang motivasi, saya bisa mempelajari motivasi dala diri saya sekarang dan juga pengaruh dari lingkungan kerja say serta pengaruh untuk lingkungan kerja saya.
    Saya setuju bhwa motivasi mempengaruhi kinerja kita. Itu saya rasakan sendiri sejak saya menjadi guru di sekolah tempat saya bekerja. 2 tahun pertama sy sangat semangat dan termotivasi bekerja karena kepercayaan atasan saya dan rekan- rekan kerja sy untuk mnjadi wakasek kurikulum wlwpun sy guru br disna. Pekerjaan saya bisa dihargai baik oleh atasan sy. Namun sayangnya lingkungan kerja yang semakin hari sy rasakan semakin krg nyaman karena krgnya prhtian, penghargaan dari atasan, motivasi sy pun menurun. Selain saya pun, saya menilai rekan_ rekan saya pun mengalami penurunan kinerja karena semangat atau motivasi bekerja pun menurun. Mereka merasa krgnya prhtian atasan trhdp kesejahteraan guru2 dan perhatian tentang kgtan di sklh. Mereka merasa karena atasan sering kgtan dns di luar maka merasa lepas pengawasan dan merasa tdk ada perhatian dr atasan. Kmi hnya bs saling menyemangati dan slg mengingatkan untk ttap bekerja dgn pnuh tnggung jwb. Namu sbgian guru mengaggap pkrjaan nya tdk dinilai atau dihrgai. Jd mreka brpikir untk sama dengan rekan yg kinerja nya rendah. Semoga setelah membaca artikel bapak, saya bs mngatasi masalah sy dan rekan_ rekan di sklh yg mngalami penurunan motivasi wlw tnpa pngawasan atau penghrgaan dr atasan sklipun dan hanya mengingat tgs serta kwjbn kita sbg pendidik. Trima ksh. Wassalam
    Dedeh septy kurniasih
    Nim. 72113109
    Kelas E11

  149. 158 Ikeu Aprilianti February 7, 2014 at 7:34 pm

    Assalamualaikum wr.wb.
    Menurut saya pengaruh motivasi terhadap peningkatan kinerja sangatlah besar, sebelum membahas kinerja tentunya kita harus memikirkan, bagaimana caranya seorang pegawai termotivasi untuk belajar sehingga nantinya berpengaruh terhadap peninggkatan kinerja karyawan itu sendiri. Banyaknya karyawan TU ( Tatat Usaha ) di sekolah kami yang demotivasi sehingga menyebabkan rendahnya pelayanan terhadap guru maupun siswa. Diklat sebagai salah satu cara untuk belajar harus dapat dimanfaatkan sebagai salah satu cara untuk meningkatkan kompetensi sehingga meningkatkan motivasi dan kesadaran para pegawai untuk bekerja lebih baik di sekolah. Oleh karena itu diklat harus dirancang sedemikian rupa sehinggga meningkatkan motivasi internal maupun eksternal pegawai. Pegawai akan termotivasi untuk belajar jika meteri yang diajarkan pada diklat berhubungansecara langsung dengan pekerjaan mereka, sehingga meraka bekerja lebih baik. Selain hal di atas, diklat juga harus memberikan keuntungan secara nyata sehingga pegawai akan lebih termotivasi untuk belajar, jika mereka mengetahui bahwa diklat tersebut mengguntungkan bagi mereka, sehingga otomatis memberikan dampak bagi peningkatan kinerja.
    Jadi sangatlah jelas bahwa peran motivasi sangatlah besar pengaruhnya terhadap kinerja seseorang. Apabila pegawai telah memiliki motivas untuk belajar, diharapkan ia pun memiliki motivasi yang tinggi untuk bekerja dam memberikan kontribusi terbaiknya bagi instansi atau perusahaan dimana dia bekerja. Dan apabila justru demotivasi yang ada pada diri karyawan maka sudah dapat kita prediksi kebangkrutan tinggal menunggu waktu. Demikian komentar dari saya mengenai tulisan Bapak. Mohon maaf bila ada kekeliruan dalam komentar saya. Wassalamualaikum Wr.Wb.
    Ikeu Aprilianti
    Mahasiswa Pasca Sarjana UNPAK, Jurusan Administrasi Pendidikan
    Kelas E.11
    NPM: 072113117

  150. 159 NINA ANDRIANITA February 7, 2014 at 11:43 pm

    YTH BAPAK EDIE.. yang baik hati dan tidak sombong… hehehheheheh

    Menarik sekali tulisan yang bapak muat,
    ini dapat menanbah pengetahuan saya tentang motivasi,
    tapi jadi nambah penasaran nie pak ,

    Manullang (1982:147) memberikan pengertian tentang motivasi kerja : “Motivasi kerja tidak lain adalah suatu yang menimbulkan dorongan atau semangat kerja, dengan kata lain motivasi kerja adalah pendorong semangat kerja Merumuskan suatu pengertian motivasi bukanlah merupakan suatu hal yang sederhana. Motivasi merupakan suatu proses yang terjadi dalam diri manusia atau suatu proses psikologi”.

    “Semangat kerja adalah kemampuan sekelompok orang-orang untuk bekerja sama dengan giat dan konsekuen dalam mengejar tujuan bersama. Bekerja sama dengan menekankan dengan tugas hakekat saling hubungan dari suatu kelompok dengan suatu keinginan yang nyata untuk bekerja sama. Dengan giat dan konsekuen menunjukkan caranya untuk sampai pada tujuan melalui disiplin dan tanggungjawab bersama”. Leighten (1985:185)

    Jika di lihat dari dua pendapat akhli tersebut keberadaan motivasi sangat penting peranannya, dalam usaha meningkatkan kualitas dan kuantitas kerja yang dihasilkan. Motivasi akan memberikan dorongan dan semangat bagi karyawan dan pimpinan. Adanya kepuasan kerja diharapkan akan menciptakan hubungan kerja yang harmonis antara kedua belah pihak yaitu karyawan dan pimpinan, sehingga tujuan instansi atau perusahaan dapat tercapai dan berhasil secara optimal. Motivasi sangat penting dimiliki oleh karyawan dalam meningkatkan semangat kerja dan produktivitas karyawan.
    Namun jika kita mencoba mengelompokan
    maka motivasi dibagi dua hal pertama motivasi materil (pemberian dengan bentuk materi ) dan motivasi non materil (penghargaan, pengakuan dsb) jika di lihat dari segi psikologi maka motivasi non material memiliki peranan yang sangat besar di banding motivasi materil, nah dalam hal ini karena bapak seorang dosen kirannya mau mengkaji dan berbagi pengetahuan tentang seberapa besar peran motivasi materil dan non materil terhadap kinerja.. suksess ya bapak semoga sehat selalu……. suksess yaa pak edie… “NINA ANDRIANITA /Npm 072113165/ Kelas E 11 PASCA UNPAK…..

  151. 160 Performance Tech Adie February 8, 2014 at 1:53 am

    Yth Bapak Ibu
    Pada dasarnya konsep dan prinsip motivasi dapat diterapkan di berbagai bidang kehidupan seperti keluarga, sekolah, perusahaan, lembaga sosial serta masyarakat dan negara. Banyak studi yang membuktikan motivasi berkorelasi signifikan terhadap kinerja individu dan organisasi. Hanya saja aspek-aspek dalam motivasi yang berbeda sesuai dengan bidang pekerjaan. Oleh karena itu, riset yang berkelanjutan terkait motivasi dan kinerja masih perlu terus dilakukan.
    Adie Yusuf

  152. 161 Astuti Karya Dewi Mahasiswi Pascasarjana UnPak S3B2. NPM 073113032 February 13, 2014 at 1:37 am

    Assalamualaikum, Selamat pagi, salam sejahtera untuk kita semua, semoga Allah Yang maha Kuasa selalu memberkati kita semua.

    Bapak nama saya Astuti Karya Dewi, Mahasiswi Pascasarjana UnPak Kelas S3B2,

    Pengaruh Motivasi Terhadap Kinerja Kerja.
    Setelah saya membaca tulisan bapak mengenai Pengaruh motivasi terhadap kinerja kerja, saya sangat sependapat dengan bapak, dan saya juga berpendapat apapun bentuk aktivitas seseorang dia memerlukan motivasi agar dapat memberikan dorongan atas kerjanya.
    Siapa yang tidak memerlukan motivasi dalam hidupnya?.
    Boleh dikatakan tidak ada orang yang tidak memerlukan motivasi dalam menghadapi aktivitas yang dilakukannya, siapun orangnya anak anak, oarng dewasa, orang tua. semua memerlukan motivasi agar bisa mendorong dia melaksanakan aktivitasnya dengan tepat, cepat dan baik.
    Moslow dalam teori kebutuhan, manusia memerlukan adanya Aktualisasi diri, penghargaan, kasih sayang, rasa aman dan kebutuhan pisikologie, jika kelima macam ini sudah terpenuhi maka manusia akan dapat melaksanakan aktivitasnya dengan baik.aktualisasi diri atau kata lainnya pengakuan akan keberadaan, penghargaan dan kasih sayang merupakan suatu bentuk perhatiaan yang akan mjendorong orang mencintai pekerjaannya, ditambah rasa aman dan terpenuhinya kebutuhan pisiknya, membuat rasa nyaman bagi pelaku pekerjaan, pekerja yang mendapat motivasi akan menekuni dan menyelesaikan setiap pekerjaannya dengan baik dibandingkan pekerja yang bekerja tanpa motivasi dan perhatian, anak yang mendapat motivasi atau dukungan yang positive akan menghasilakan anak yang bertingkah laku baik dibandingkan anak yang mengalami pembiaran, orang tua yang lagi sakit akan berusaha dan cepat sembuh bila dimotivasi dengan baik, dibandingkan bila ditelantarkan, jadi Pengaruh motivasi sangat besar dengan hasil kinerja kerja, semoga tulisan bapak bisa dibaca semua kalangan, baik pimpinan perusahaan, orang tua, maupun orang orang yang harusnya dapat memberikan motivasi bagi kalangan terdekatnya.
    Lubuk Linggau 13 Feb 2014

  153. 162 lili angraini pasca sarjana Administrasi pendidikan UNPAK kelas E 11 February 14, 2014 at 11:01 am

    Assalamu’alaikum Wr. Wb
    Yang terhormat Bapak Dr. H. Adie.E. Yusuf. M.A

    Setelah membaca tulisan bapak mengenai motivasi, menurut saya setiap individu harus memiliki motif dan motivasi yang terarah dalam melakukan sebuah aktivitas agar tujuan dapat tercapai. Bila hal itu diaktualisasikan dalam pekerjaan dalam hal ini mengajar dan mendidik , motivasi dibutuhkan agar baik itu pendidik dan peserta memiliki upaya yang tinggi untuk mencapai tujuan pendidikan. Semua hal itu akan terwujud bila terdapat upaya dalam menetapkan prioritas sehingga semua elemen yang tercakup dalam proses pendidikan memiliki upaya yang berdaya guna dan berhasil guna.

    Proses motivasi di dunia pendiikan harus berangkat dari paradigma bahwa pendidikan merupakan sebuah kebutuhan bahkan sebagai investasi manusia atau ” human capital”. Bila hal ini telah terkonsep, maka aspek kebutuhan tersebut akan menjadi tolak ukur peningkatan perilaku pelaku pendidikan.

    Dari lima teori motivasi yang bapak telah jabarkan, saya memiih teori berprestasi yang dicetuskan oleh David Mc Clelland. Menurut saya teori motivasi ini bisa diterapkan di dalam proses pendidikan karena dalam teori tersebut menjelaskan tentang keinginan seseorang untuk mencapai kinerja yang tinggi. Hal ini berkaitan dengan dengan tiga macam kebutuhan yang dimiliki oleh setiap individu yaitu :
    1. kebutuhan berprestasi ( achievement motivation )
    2. Kebutuhan berkuasa ( power motivation )
    3. kebutuhan berafiliasi ( affiliation motivation )

    Akan tetapi 3 motivasi tersebut akan tumbuh bila adanya motif yang kuat dari masing-masing individu.
    Motivasi untuk berprestasi bisa dibangun oleh para pendidik dengan cara meningkatkan tanggung jawab pribadi seperti datang tepat waktu atau menyelesaikan tugas-tugas administrasi sebagai guru, selain itu mencari dan menggali terus menerus sumber bahan ajar juga bisa menjadi salah satu bagian dalam memacu motivasi untuk berprestasi.
    Sedangkan dari segi siswa sebagai peserta didik, motif ini dapat dibangun dengan menanamkan tanggungjawab sejak awal, bahwa belajar adalah proses menuju hidup lebih baik dengan cara menambah iptek dari segala sumber dan penguatan etika untuk terus berkembang

    Motivasi untuk berkuasa di dunia pendidikan dapat diartikan sebagai adanya pembagian kerja yang jelas dan terstruktur, terdapat kejelasan mana pimpinan mungkin dalam hal ini kepala sekolah, terdapat juga kejelasan staf serta para guru. Selain itu motibvasi berkuasa juga memiliki peran dalam hal memberikan pengaruh positif dalam proses pencapaian tujuan pendidikan.

    Motivasi berafiliasi yang menyangkut kerjasama di dalam kegiatan pendidikan dan adanya perasaan diterima bagi ke dua belah pihak baik itu pendidik dan peserta didik. Dalam jangkauan yang lebih luas yaitu adanya usaha aktif dalam membangun lingkungan yang kondusif untuk mencapai tujuan pendidikan.

    Pada akhirnya untuk mencapai kinerja yang baik terutama dalam hal mengajar dan mendidik harus terdapat keselarasan dan keseimbangan dalam mengatualisasikan motivasi-motivasi yang ada. Demikian pendapat saya, terima kasih.
    Wassalamu’alaikum Wr.Wb

    Lili Angraini/ 72113119/E11

  154. 163 aam amaliah February 17, 2014 at 3:53 pm

    Aam Amaliah
    17 Februari 2014

    Assalamua’laikum wr.wb
    Yang terhormat Bapak Dr.H.Adie.E.Yusuf, M.A.

    Setelah membaca tulisan bapak, saya mendapatkan “pencerahan” mengenai teori-teori motivasi yang begitu lengkap dan pentingnya memiliki motivasi untuk meningkatkan kinerja. Semoga saya memiliki motivasi yang tinggi dalam bekerja sehingga saya bisa berkontribusi dalam memajukan pendidikan di indonesia. Amin

  155. 164 Kania Aprianti October 7, 2012 at 8:34 am

    Assalamualaikum Wr Wb…….
    Salam kenal pa Adie…….

    Comment saya tentang “Pengaruh Motivasi dalam peningkatan Kinerja “…..
    Dari teori Maslow disebutkan salah satunya yaitu : motivasi muncul karena kebutuhan rasa aman & tentram, hal ini menunjukan bahwa manusia akan bekerja dengan motivasi tinggi ketika kebutuhan rasa aman & tentram itu sudah ia dapatkan. Misalnya seorang karyawan yang mendapatkan tunjangan hari tua, asuransi kesehatan, dll untuk dirinya & keluarga, ia akan menunjukan motivasi kerja yang tinggi di perusahaan tempatnya bekerja, karena ketika sesuatu terjadi pada dirinya & keluarga, ia merasa tenang karena sudah ada pihak yang menanggung resiko atas kejadian tersebut.

    Demikian sekilas comment dari saya, mudah-mudahan bermanfaat. Terimakasih.

    Kania Aprianti
    Mahasiswa Semester I Pasca Sarjana Unpak
    NPM : 072112188

  156. 165 nunun October 9, 2012 at 11:21 am

    Assalamualaikum wr wb,
    Selamat sore pak, saya nunun nurlaela mahasiswi semester satu pasca sarjana E 10 asal Sukabumi, Saya tertarik dengan materi dari bapak tentang “tanda-tanda karyawan yg motivasinya baik dan karyawan yang motivasinya buruk”. Menurut pendapat saya, selain pendekatan antisipatif dan kuratif , figur pemimpin atau keteladanan pemimpin dalam bersikap dan bertindak juga bisa meningkatkan motivasi kinerja karyawan, hal ini dilatar belakangi oleh budaya bangsa kita yang masih bersifat paternalistik harismatik , selain itu juga pemberian reward dan sangsi/hukuman yang proporsional, jelas dan tegas, juga dapat mendorong gairah karyawan dalam meningkatkan kinerjanya. Mungkin sementara hanya ini komentar dari saya, semoga bermanfaat.
    Wassalamualaikum wr wb.

    Nunun Nurlaela
    Mahasiswi Semester 1 Pasca Sarjana Unpak

  157. 166 Slamet Makmuri April 27, 2013 at 3:10 am

    Assalamulaikum wr. wb
    Terimakasih atas tulisan Bapak, selain saya tentu masih banyak lagi yang memerlukan apa yang Bapak tulis, sangat dinanti tulisan-tulisan yang lain, semoga Allah SWT membalas kebaikan Bapak, amien

    Slamet, S.Pd
    Mahasiswa Pascasarjana S2 Udinus Semarang

  158. 167 lina marlina February 6, 2014 at 5:24 am

    Assalamualaikum W,W.

    Saya telah membaca tulisan Bapak, Saya angat setuju bahwa motivasi

    mutlak diperlukan setiap individu, dengan motivasi akan tergerak untuk

    lebih maju dan giat tanpa cepat menyerah atau frustasi hingga mencapai

    apa yang kita inginkan. Motivasi bisa muncul dari diri masing masing dan

    dari luar/ faktor eksternal. Setiap tujuan yang ingin kita capai senantiasa

    tidak selalu sesuai dengan kenyataan, namun apabila memiliki motivasi

    yang kuat insyaAllah tidak mudah menyerah. Motivasipun harus

    didukung dengan lingkungan yang kondusif misalnya lingkungan

    keluarga dan lingkungan kerja yang nyaman sehingga membangkitkan

    semangat kerja pada diri kita bahkan mejadsi suatu Prestasi dan Prestise

    tak lupa motivasi juga harus didasari dengan ikhlas dan rasa tulus

    sehingga tidak menjadi beban pada diri kita sendiri. Demikian komentar

    saya atas artikel yang Bapak tulis, Terimakasih.

    Lina Marliana


    Kelas: E-11

  159. 168 Herman February 7, 2014 at 5:54 am

    Assalamu’alaikum Wr. Wb
    Yang terhormat Bapak Dr. H. Adie.E. Yusuf. M.A
    Ijinkan saya untuk memberi sedikit kajian tentang tulisan bapak yang bertema”PENGARUH MOTIVASI TERHADAP PENINGKATAN KINERJA”
    Dalam artikel tetulis beberapa teori motivasi yang sangat penting, diantaranya:
    1. Teori Efek Hawthorn
    2. Teori kebutuhan
    3. Teori X dan Y
    4. Teori Hygine dan motivator
    5. Teori Motivasi
    Ciri-ciri perilaku karyawan yang memiliki motivasi berprestasi tinggi menurut McClelland
    1. Menyukai tanggungjawab untuk memecahkan masalah
    2. Cenderung menetapkan target yang sulit dan berani mengambil resiko
    3. Memiliki tujuan yang jelas dan realistis
    4. Memiliki rencana kerja yang menyeluruh
    5. Lebih mementingkan umpan balik yang nyata tentang prestasinya
    6. Senang dengan tugas yang dilakukan dan selalu ingin menyelesaikan dengan sempurna
    Setelah membaca artikel bapak, saya dapat membedakan antara seseorang yang memiliki motivasi berprestasi kerja tinggi dan seseorang yang memiliki motivasi berprestasi kerja rendah.Motivasi sangat dibutuhkan oleh saya . Menurut bapak, Motivasi merupakan salah satu faktor kunci untuk bekerja dan mencapai kinerja yang tinggi . Semangat bekerja itu seperti iman seseorang, kadang naik kadang turun,dibutuhkan motivasi untuk mendorong seseorang untuk melakukan suatu pekerjaan sehingga selalu bersikap dan berpikir positif,tulus, menjaga keseimbangan sikap, adapun untuk mengatasi penurunan motivasi dalam pekerjaan dapat dilakukan melalui pendekatan kuratif dan pendekatan antisipatif.
    Semoga saya termasuk orang yang bisa bekerja sebaik baiknya , tidak mengenal kata” putus asa” dan selalu berpikir positif.
    Demikian komentar saya, mohon maaf bila ada yang kurang berkenan.
    Wassalamu’alaikum Wr.Wb

    NIM : 72113161
    Kelas E.11
    Pascasarjana UNPAK

Leave a Reply

Fill in your details below or click an icon to log in: Logo

You are commenting using your account. Log Out / Change )

Twitter picture

You are commenting using your Twitter account. Log Out / Change )

Facebook photo

You are commenting using your Facebook account. Log Out / Change )

Google+ photo

You are commenting using your Google+ account. Log Out / Change )

Connecting to %s

May 2008
    Jul »



Blog Stats

  • 102,508 hits


Get every new post delivered to your Inbox.

Join 39 other followers

%d bloggers like this: